GABA A Receptor beta 2(GABRB2) (NM_021911) Human Tagged ORF Clone

CAT#: RC217467

GABRB2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, beta 2 (GABRB2), transcript variant 1

Change vector?

USD 660


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GABA A Receptor beta 2(GABRB2) (NM_021911) Human Tagged ORF Clone
Symbol GABRB2
Synonyms MGC119386; MGC119388; MGC119389
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217467 representing NM_021911
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGAGAGTGCGGAAAAGGGGCTACTTTGGGATTTGGTCCTTCCCCTTAATAATCGCCGCTGTCTGTG
CGCAGAGTGTCAATGACCCTAGTAATATGTCGCTGGTTAAAGAGACGGTGGATAGACTCCTGAAAGGCTA
TGACATTCGTCTGAGACCAGATTTTGGAGGTCCCCCCGTGGCTGTGGGGATGAACATTGACATTGCCAGC
ATCGATATGGTTTCTGAAGTCAATATGGATTATACCTTGACAATGTACTTTCAACAAGCCTGGAGAGATA
AGAGGCTGTCCTATAATGTAATACCTTTAAACTTGACTCTGGACAACAGAGTGGCAGACCAGCTCTGGGT
GCCTGATACCTATTTCCTGAACGATAAGAAGTCATTTGTGCACGGAGTGACTGTTAAGAACCGCATGATT
CGCCTGCATCCTGATGGCACCGTCCTTTATGGACTCAGAATCACAACCACAGCTGCCTGCATGATGGACC
TAAGGAGGTACCCACTGGATGAACAAAACTGCACCTTGGAAATTGAGAGCTATGGATACACAACTGATGA
CATTGAGTTTTACTGGCGTGGCGATGATAATGCAGTAACAGGAGTAACGAAAATTGAACTTCCACAGTTC
TCTATTGTAGATTACAAACTTATCACCAAGAAGGTTGTTTTTTCCACAGGTTCCTATCCCAGGTTATCCC
TCAGCTTTAAGCTTAAGAGAAACATTGGCTACTTTATCCTGCAAACATACATGCCTTCCATCCTGATTAC
CATCCTCTCCTGGGTCTCCTTCTGGATTAATTACGATGCTTCAGCTGCAAGGGTGGCATTAGGAATCACA
ACTGTCCTCACAATGACCACAATCAACACCCACCTCCGGGAAACTCTCCCTAAAATCCCCTATGTGAAGG
CCATTGACATGTACCTGATGGGGTGCTTTGTCTTCGTTTTCATGGCCCTTCTGGAATATGCCCTAGTCAA
CTACATCTTCTTTGGGAGGGGGCCCCAACGCCAAAAGAAAGCAGCTGAGAAGGCTGCCAGTGCCAACAAT
GAGAAGATGCGCCTGGATGTCAACAAGATTTTTTATAAAGATATTAAACAAAATGGGACCCAATATCGAT
CCTTGTGGGACCCTACTGGAAACCTCTCCCCAACTAGACGGACTACCAATTACGATTTCTCTCTGTATAC
GATGGACCCCCATGAGAACATCTTACTGAGCACTCTCGAGATAAAAAATGAAATGGCCACATCTGAGGCT
GTGATGGGACTTGGAGACCCCAGAAGCACAATGCTAGCCTATGATGCCTCCAGCATCCAGTATCGGAAAG
CTGGGTTGCCCAGGCATAGTTTTGGCCGAAATGCTCTGGAACGACATGTGGCGCAAAAGAAAAGTCGCCT
GAGGAGACGCGCCTCCCAACTGAAAATCACCATCCCTGACTTGACTGATGTGAATGCCATAGATCGGTGG
TCCCGCATATTCTTCCCAGTGGTTTTTTCCTTCTTCAACATCGTCTATTGGCTTTATTATGTGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217467 representing NM_021911
Red=Cloning site Green=Tags(s)

MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIAS
IDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMI
RLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQF
SIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIT
TVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANN
EKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA
VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRW
SRIFFPVVFSFFNIVYWLYYVN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021911
ORF Size 1536 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021911.1, NM_021911.2, NP_068711
RefSeq Size 1974
RefSeq ORF 1539
Locus ID 2561
Cytogenetics 5q34
Domains Neur_chan_memb, Neur_chan_LBD
Protein Families Ion Channels: Cys-loop Receptors, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 59 kDa
Gene Summary The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. Alternative splicing of this gene generates 2 transcript variants, differing by a 114 bp insertion. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations