HIF1 beta (ARNT) (NM_178426) Human Tagged ORF Clone

SKU
RC217284
ARNT (Myc-DDK-tagged)-Human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HIF1 beta
Synonyms aryl hydrocarbon receptor nuclear translocator; bHLHe2; dioxin receptor, nuclear translocator; HIF-1beta; HIF1B; HIF1BETA; hypoxia-inducible factor 1, beta subunit; OTTHUMP00000032943; TANGO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217284 representing NM_178426
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGACTACTGCCAACCCCGAAATGACATCAGATGTACCATCACTGGGTCCAGCCATTGCCTCTG
GAAACTCTGGACCTGGAATTCAAGGTGGAGGAGCCATTGTCCAGAGGGCTATTAAGCGGCGACCAGGGCT
GGATTTTGATGATGATGGAGAAGGGAACAGTAAATTTTTGAGGTGTGATGATGATCAGATGTCTAACGAT
AAGGAGCGGTTTGCCAGGTCGGATGATGAGCAGAGCTCTGCGGATAAAGAGAGACTTGCCAGGGAAAATC
ACAGTGAAATTGAACGGCGGCGACGGAACAAGATGACAGCCTACATCACAGAACTGTCAGATATGGTACC
CACCTGTAGTGCCCTGGCTCGAAAACCAGACAAGCTAACCATCTTACGCATGGCAGTTTCTCACATGAAG
TCCTTGCGGGGAACTGGCAACACATCCACTGATGGCTCCTATAAGCCGTCTTTCCTCACTGATCAGGAAC
TGAAACATTTGATCTTGGAGGCAGCAGATGGCTTTCTGTTTATTGTCTCATGTGAGACAGGCAGGGTGGT
GTATGTGTCTGACTCCGTGACTCCTGTTTTGAACCAGCCACAGTCTGAATGGTTTGGCAGCACACTCTAT
GATCAGGTGCACCCAGATGATGTGGATAAACTTCGTGAGCAGCTTTCCACTTCAGAAAATGCCCTGACAG
GGCGTATCCTGGATCTAAAGACTGGAACAGTGAAAAAGGAAGGTCAGCAGTCTTCCATGAGAATGTGTAT
GGGCTCAAGGAGATCGTTTATTTGCCGAATGAGGTGTGGCAGTAGCTCTGTGGACCCAGTTTCTGTGAAT
AGGCTGAGCTTTGTGAGGAACAGATGCAGGAATGGACTTGGCTCTGTAAAGGATGGGGAACCTCACTTCG
TGGTGGTCCACTGCACAGGCTACATCAAGGCCTGGCCCCCAGCAGGTGTTTCCCTCCCAGATGATGACCC
AGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217284 representing NM_178426
Red=Cloning site Green=Tags(s)

MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND
KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK
SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY
DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN
RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178426
ORF Size 984 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178426.1, NP_848513.1
RefSeq Size 3563 bp
RefSeq ORF 986 bp
Locus ID 405
Cytogenetics 1q21.3
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Renal cell carcinoma
MW 35.8 kDa
Summary This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013]
Write Your Own Review
You're reviewing:HIF1 beta (ARNT) (NM_178426) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217284L3 Lenti ORF clone of Human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC217284L4 Lenti ORF clone of Human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2, mGFP tagged 10 ug
$600.00
RG217284 ARNT (tGFP-tagged) - Human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2 10 ug
$500.00
SC312979 ARNT (untagged)-Human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.