CYB5R2 (NM_016229) Human Tagged ORF Clone

SKU
RC217261
CYB5R2 (Myc-DDK-tagged)-Human cytochrome b5 reductase 2 (CYB5R2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $457.00 MSRP $457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CYB5R2
Synonyms B5R.2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217261 representing NM_016229
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTCCAGGAGGAGAGAGCCAATCACCTTACAGGACCCTGAAGCCAAGTACCCGCTGCCCTTGATTG
AGAAAGAGAAAATCAGCCACAACACCCGGAGGTTCCGCTTTGGACTGCCTTCGCCGGACCATGTCTTAGG
GCTTCCTGTAGGTAACTATGTCCAGCTCTTGGCAAAAATCGATAATGAATTGGTGGTCAGGGCTTACACC
CCTGTCTCCAGTGATGATGACAGAGGCTTTGTGGACCTAATTATAAAGATCTACTTCAAAAATGTACACC
CCCAATATCCTGAAGGTGGGAAGATGACTCAGTATTTGGAGAACATGAAAATCGGGGAGACCATCTTTTT
TCGAGGGCCAAGGGGACGCTTGTTTTACCATGGGCCAGGGAATCTTGGAATCAGACCAGACCAGACGAGT
GAGCCTAAAAAAACACTGGCCGATCACCTGGGAATGATTGCTGGGGGCACAGGCATCACACCCATGTTGC
AGCTCATTCGCCACATCACCAAGGACCCCAGTGACAGGACCAGGATGTCCCTCATCTTTGCCAACCAGGT
CAGTTCCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217261 representing NM_016229
Red=Cloning site Green=Tags(s)

MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYT
PVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTS
EPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQVSSC

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016229
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 1341 bp
RefSeq ORF 831 bp
Locus ID 51700
UniProt ID Q6BCY4
Cytogenetics 11p15.4
Domains FAD_binding_6, NAD_binding_1
Protein Families Druggable Genome
MW 21.54 kDa
Summary The protein encoded by this gene belongs to the flavoprotein pyridine nucleotide cytochrome reductase family of proteins. Cytochrome b-type NAD(P)H oxidoreductases are implicated in many processes including cholesterol biosynthesis, fatty acid desaturation and elongation, and respiratory burst in neutrophils and macrophages. Cytochrome b5 reductases have soluble and membrane-bound forms that are the product of alternative splicing. In animal cells, the membrane-bound form binds to the endoplasmic reticulum, where it is a member of a fatty acid desaturation complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:CYB5R2 (NM_016229) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217261L3 Lenti-ORF clone of CYB5R2 (Myc-DDK-tagged)-Human cytochrome b5 reductase 2 (CYB5R2) 10 ug
$757.00
RC217261L4 Lenti-ORF clone of CYB5R2 (mGFP-tagged)-Human cytochrome b5 reductase 2 (CYB5R2) 10 ug
$757.00
RG217261 CYB5R2 (tGFP-tagged) - Human cytochrome b5 reductase 2 (CYB5R2) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC114350 CYB5R2 (untagged)-Human cytochrome b5 reductase 2 (CYB5R2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.