Transmembrane protein 30A (TMEM30A) (NM_018247) Human Tagged ORF Clone

SKU
RC217257
TMEM30A (Myc-DDK-tagged)-Human transmembrane protein 30A (TMEM30A), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Transmembrane protein 30A
Synonyms C6orf67; CDC50A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217257 representing NM_018247
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGATGAACTATAACGCGAAGGATGAAGTGGACGGTGGGCCCCCGTGTGCTCCGGGGGGCACCGCGA
AGACTCGGAGACCGGATAACACGGCCTTCAAACAGCAACGGCTGCCAGCTTGGCAGCCCATCCTTACGGC
TGGCACGGTGCTACCTATTTTCTTCATCATCGGTCTCATCTTCATTCCCATCGGCATTGGCATTTTTGTC
ACCTCCAACAACATCCGCGAGATCGAGATTGATTATACCGGAACAGAGCCTTCCAGTCCCTGTAATAAAT
GTTTATCTCCGGATGTGACACCTTGCTTTTGTACCATTAACTTCACACTGGAAAAGTCATTTGAGGGCAA
CGTGTTTATGTATTATGGACTGTCTAATTTCTATCAAAACCATCGTCGTTACGTGAAATCTCGAGATGAT
AGTCAACTAAATGGAGATTCTAGTGCTTTGCTTAATCCCAGTAAGGAATGTGAACCTTATCGAAGAAATG
AAGACAAACCAATTGCTCCTTGTGGAGCTATTGCCAACAGCATGTTTAATGATACATTAGAATTGTTTCT
CATTGGCAATGATTCTTATCCTATACCTATCGCTTTGAAAAAGAAAGGTATTGCTTGGTGGACAGATAAA
AATGTGAAATTCAGAAATCCCCCTGGAGGAGACAACCTGGAAGAACGATTTAAAGGTACAACAAAGCCTG
TGAACTGGCTTAAACCAGTTTACATGCTGGATTCTGACCCAGATAATAATGGATTCATAAATGAGGATTT
TATTGTTTGGATGCGTACTGCAGCATTACCTACTTTTCGCAAGTTGTATCGTCTTATAGAAAGGAAAAGT
GATTTACATCCAACATTACCAGCTGGCCGATACTCTTTGAATGTCACATACAATTACCCTGTACATTATT
TTGATGGACGAAAACGGATGATCTTGAGCACTATTTCATGGATGGGAGGAAAAAATCCATTTTTGGGGAT
TGCTTACATCGCTGTTGGATCCATCTCCTTCCTTCTGGGAGTTGTACTGCTAGTAATTAATCATAAATAT
AGAAACAGTAGTAATACAGCTGACATTACCATT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217257 representing NM_018247
Red=Cloning site Green=Tags(s)

MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFV
TSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDD
SQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDK
NVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKS
DLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKY
RNSSNTADITI

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_018247
ORF Size 1083 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018247.4
RefSeq Size 4410 bp
RefSeq ORF 1086 bp
Locus ID 55754
UniProt ID Q9NV96
Cytogenetics 6q14.1
Domains CDC50
Protein Families Druggable Genome, Transmembrane
MW 40.5 kDa
Summary Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. The beta subunit may assist in binding of the phospholipid substrate. Required for the proper folding, assembly and ER to Golgi exit of the ATP8A2:TMEM30A flippase complex. ATP8A2:TMEM30A may be involved in regulation of neurite outgrowth, and, reconstituted to liposomes, predomiminantly transports phosphatidylserine (PS) and to a lesser extent phosphatidylethanolamine (PE). The ATP8A1:TMEM30A flippase complex seems to play a role in regulation of cell migration probably involving flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. Required for the formation of the ATP8A2, ATP8B1 and ATP8B2 P-type ATPAse intermediate phosphoenzymes. Involved in uptake of platelet-activating factor (PAF), synthetic drug alkylphospholipid edelfosine, and, probably in association with ATP8B1, of perifosine. Also mediate the export of alpha subunits ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B and ATP11C from the ER to other membrane localizations.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Transmembrane protein 30A (TMEM30A) (NM_018247) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217257L1 Lenti ORF clone of Human transmembrane protein 30A (TMEM30A), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC217257L2 Lenti ORF clone of Human transmembrane protein 30A (TMEM30A), transcript variant 1, mGFP tagged 10 ug
$986.00
RC217257L3 Lenti ORF clone of Human transmembrane protein 30A (TMEM30A), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC217257L4 Lenti ORF clone of Human transmembrane protein 30A (TMEM30A), transcript variant 1, mGFP tagged 10 ug
$986.00
RG217257 TMEM30A (tGFP-tagged) - Human transmembrane protein 30A (TMEM30A), transcript variant 1 10 ug
$886.00
SC113612 TMEM30A (untagged)-Human transmembrane protein 30A (TMEM30A), transcript variant 1 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.