DCTD (NM_001921) Human Tagged ORF Clone

SKU
RC217231
DCTD (Myc-DDK-tagged)-Human dCMP deaminase (DCTD), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DCTD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217231 representing NM_001921
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGGCGGGGGCCAGCCGTGCGGACCCAACATGAGTGAAGTTTCCTGCAAGAAACGGGACGACTATT
TGGAATGGCCAGAGTATTTTATGGCTGTGGCCTTCTTATCAGCACAGAGAAGCAAAGATCCAAATTCCCA
GGTCGGCGCCTGCATCGTGAATTCAGAAAACAAGATTGTCGGGATTGGGTACAATGGGATGCCAAATGGG
TGCAGTGATGACGTGTTGCCTTGGAGAAGGACAGCAGAGAATAAGCTGGACACCAAATACCCGTACGTGT
GCCATGCGGAGCTGAATGCCATCATGAACAAAAATTCGACCGATGTGAAAGGCTGTAGTATGTATGTTGC
CTTGTTCCCTTGTAATGAATGCGCTAAGCTCATCATCCAGGCAGGTATAAAAGAAGTGATTTTCATGTCT
GATAAATACCATGATAGTGACGAGGCAACTGCTGCGAGGCTCCTGTTTAATATGGCCGGGGTGACATTCC
GGAAATTCATACCGAAGTGCAGCAAGATTGTCATTGACTTTGATTCAATTAACAGCAGACCGAGTCAAAA
GCTTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217231 representing NM_001921
Red=Cloning site Green=Tags(s)

MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNG
CSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMS
DKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001921
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 2019 bp
RefSeq ORF 537 bp
Locus ID 1635
UniProt ID P32321
Cytogenetics 4q35.1
Domains dCMP_cyt_deam
Protein Pathways Metabolic pathways, Pyrimidine metabolism
MW 21.01 kDa
Summary The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DCTD (NM_001921) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217231L3 Lenti ORF clone of Human dCMP deaminase (DCTD), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC217231L4 Lenti ORF clone of Human dCMP deaminase (DCTD), transcript variant 2, mGFP tagged 10 ug
$600.00
RG217231 DCTD (tGFP-tagged) - Human dCMP deaminase (DCTD), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118945 DCTD (untagged)-Human dCMP deaminase (DCTD), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.