CREM (NM_182719) Human Tagged ORF Clone

SKU
RC217044
CREM (Myc-DDK-tagged)-Human cAMP responsive element modulator (CREM), transcript variant 6
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CREM
Synonyms CREM-2; hCREM-2; ICER
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217044 representing NM_182719
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTAACTGGAGATGACACAGATGAGGAAACTGAACTTGCCCCAAGTCACATGGCTGCTGCCACTG
GTGACATGCCAACTTACCAGATCCGAGCTCCTACTGCTGCTTTGCCACAGGGAGTGGTGATGGCTGCATC
GCCCGGAAGTTTGCACAGTCCCCAGCAGCTGGCAGAAGAAGCAACACGCAAACGAGAGCTGAGGCTAATG
AAAAACAGGGAAGCTGCCAAAGAATGTCGACGTCGAAAGAAAGAATATGTAAAATGTCTGGAGAGCCGAG
TTGCAGTGCTGGAAGTCCAGAACAAGAAGCTTATAGAGGAACTTGAAACCTTGAAAGACATTTGTTCTCC
CAAAACAGATTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217044 representing NM_182719
Red=Cloning site Green=Tags(s)

MAVTGDDTDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLM
KNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_182719
ORF Size 363 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_182719.2
RefSeq Size 1589 bp
RefSeq ORF 366 bp
Locus ID 1390
UniProt ID Q03060
Cytogenetics 10p11.21
Protein Families Druggable Genome, Transcription Factors
MW 13.3 kDa
Summary This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CREM (NM_182719) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217044L1 Lenti ORF clone of Human cAMP responsive element modulator (CREM), transcript variant 6, Myc-DDK-tagged 10 ug
$450.00
RC217044L2 Lenti ORF clone of Human cAMP responsive element modulator (CREM), transcript variant 6, mGFP tagged 10 ug
$450.00
RC217044L3 Lenti ORF clone of Human cAMP responsive element modulator (CREM), transcript variant 6, Myc-DDK-tagged 10 ug
$450.00
RC217044L4 Lenti ORF clone of Human cAMP responsive element modulator (CREM), transcript variant 6, mGFP tagged 10 ug
$450.00
RG217044 CREM (tGFP-tagged) - Human cAMP responsive element modulator (CREM), transcript variant 6 10 ug
$489.00
SC307495 CREM (untagged)-Human cAMP responsive element modulator (CREM), transcript variant 6 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.