Gastrokine 2 (GKN2) (NM_182536) Human Tagged ORF Clone

SKU
RC216995
GKN2 (Myc-DDK-tagged)-Human gastrokine 2 (GKN2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Gastrokine 2
Synonyms BRICD1B; GDDR; PRO813; TFIZ1; VLTI465
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216995 representing NM_182536
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAATACTTGTGGCATTTCTGGTGGTGCTGACCATCTTTGGGATACAATCTCATGGATACGAGGTTT
TTAACATCATCAGCCCAAGCAACAATGGTGGCAATGTTCAGGAGACAGTGACAATTGATAATGAAAAAAA
TACCGCCATCATTAACATCCATGCAGGATCATGCTCTTCTACCACAATTTTTGACTATAAACATGGCTAC
ATTGCATCCAGGGTGCTCTCCCGAAGAGCCTGCTTTATCCTGAAGATGGACCATCAGAACATCCCTCCTC
TGAACAATCTCCAATGGTACATCTATGAGAAACAGGCTCTGGACAACATGTTCTCCAGCAAATACACCTG
GGTCAAGTACAACCCTCTGGAGTCTCTGATCAAAGACGTGGATTGGTTCCTGCTTGGGTCACCCATTGAG
AAACTCTGCAAACATATCCCTTTGTATAAGGGGGAAGTGGTTGAAAACACACATAATGTCGGTGCTGGAG
GCTGTGCAAAGGCTGGGCTCCTGGGCATCTTGGGAATTTCAATCTGTGCAGACATTCATGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216995 representing NM_182536
Red=Cloning site Green=Tags(s)

MKILVAFLVVLTIFGIQSHGYEVFNIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSSTTIFDYKHGY
IASRVLSRRACFILKMDHQNIPPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIE
KLCKHIPLYKGEVVENTHNVGAGGCAKAGLLGILGISICADIHV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_182536
ORF Size 552 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_182536.3
RefSeq Size 826 bp
RefSeq ORF 555 bp
Locus ID 200504
UniProt ID Q86XP6
Cytogenetics 2p13.3
Protein Families Secreted Protein
MW 20.3 kDa
Summary The secretory protein encoded by this gene is produced in gastric surface mucous cells, where it can bind trefoil factor family peptide 1 or gastrokine-1. This gene may be a tumor suppressor gene, as its expression is markedly decreased in gastric cancer tissues. The encoded protein interacts with gastrokine-1 and regulates homeostasis of the gastric mucosa. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:Gastrokine 2 (GKN2) (NM_182536) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216995L1 Lenti ORF clone of Human gastrokine 2 (GKN2), Myc-DDK-tagged 10 ug
$600.00
RC216995L2 Lenti ORF clone of Human gastrokine 2 (GKN2), mGFP tagged 10 ug
$600.00
RC216995L3 Lenti ORF clone of Human gastrokine 2 (GKN2), Myc-DDK-tagged 10 ug
$600.00
RC216995L4 Lenti ORF clone of Human gastrokine 2 (GKN2), mGFP tagged 10 ug
$600.00
RG216995 GKN2 (tGFP-tagged) - Human gastrokine 2 (GKN2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC307428 GKN2 (untagged)-Human gastrokine 2 (GKN2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.