MAP2 (NM_002374) Human Tagged ORF Clone

CAT#: RC216775

Reviews ()
Write a review
  • TrueORF®

MAP2 (Myc-DDK-tagged)-Human microtubule-associated protein 2 (MAP2), transcript variant 1



  "NM_002374" in other vectors (2)

USD 1,978.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name MAP2 (NM_002374) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MAP2
Synonyms MAP-2; MAP2A; MAP2B; MAP2C
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC216775 representing NM_002374
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGATGAACGGAAAGACGAAGCAAAGGCACCTCACTGGACCTCAGCACCGCTAACAGAGGCATCTG
CACACTCACATCCACCTGAGATTAAGGATCAAGGCGGAGCAGGGGAAGGACTTGTCCGAAGCGCCAATGG
ATTCCCATACAGGGAGGATGAAGAGGGTGCCTTTGGAGAGCATGGGTCACAGGGCACCTATTCAAATACC
AAAGAGAATGGGATCAACGGAGAGCTGACCTCAGCTGACAGAGAAACAGCAGAGGAGGTGTCTGCAAGGA
TAGTTCAAGTAGTCACTGCTGAGGCTGTAGCAGTCCTGAAAGGTGAACAAGAGAAAGAAGCTCAACATAA
AGACCAGACTGCAGCTCTGCCTTTAGCAGCTGAAGAAACAGCTAATCTGCCTCCTTCTCCACCCCCATCA
CCTGCCTCAGAACAGACTGTCACAGTGGAGGAAGATTTACTTACAGCCTCGAAGATGGAGTTCCACGATC
AACAGGAATTGACTCCCTCTACAGCTGAGCCTTCAGACCAGAAGGAAAAGGAGTCAGAGAAGCAAAGTAA
GCCTGGTGAAGACCTTAAACATGCTGCCTTAGTTTCTCAGCCAGAGACAACTAAAACTTACCCTGATAAA
AAGGACATGCAAGGCACAGAAGAAGAAAAAGCACCCCTAGCTTTGTTTGGGCACACTCTTGTTGCCAGCC
TGGAAGACATGAAACAGAAGACAGAACCAAGCCTTGTAGTACCTGGCATTGACCTCCCTAAAGAGCCTCC
AACTCCAAAAGAACAAAAGGACTGGTTCATCGAAATGCCAACGGAAGCAAAAAAGGATGAGTGGGGTTTA
GTTGCCCCCATATCTCCTGGCCCTCTGACTCCCATGAGGGAAAAAGATGTATTTGATGATATCCCAAAAT
GGGAAGGGAAACAGTTTGATTCTCCCATGCCAAGTCCCTTTCAAGGGGGAAGCTTCACTCTTCCTTTAGA
TGTCATGAAGAATGAAATAGTTACAGAAACATCGCCCTTTGCCCCTGCCTTTTTACAGCCAGATGACAAA
AAATCTCTGCAACAAACCAGTGGCCCAGCTACTGCCAAAGATAGTTTTAAAATTGAAGAGCCCCATGAGG
CTAAACCTGACAAAATGGCAGAAGCACCACCCTCAGAGGCAATGACCTTACCCAAAGATGCTCACATTCC
AGTTGTAGAAGAACATGTTATGGGGAAAGTTTTAGAGGAAGAAAAGGAGGCCATAAATCAAGAGACTGTG
CAGCAAAGGGATACTTTCACCCCCAGTGGACAGGAACCTATACTTACTGAAAAGGAAACTGAGCTGAAGC
TTGAAGAAAAAACCACCATTTCTGACAAAGAAGCTGTGCCAAAAGAGAGTAAACCCCCAAAACCTGCAGA
TGAAGAAATAGGCATAATTCAGACCTCCACAGAGCACACTTTCTCAGAACAGAAAGACCAAGAGCCTACC
ACAGATATGTTGAAACAGGACTCGTTCCCTGTAAGTTTGGAGCAAGCAGTTACAGATTCAGCCATGACCT
CTAAAACACTGGAGAAAGCCATGACCGAACCATCTGCATTAATTGAAAAGAGCTCAATTCAGGAACTTTT
TGAAATGAGAGTTGATGACAAAGATAAGATTGAAGGAGTTGGAGCTGCAACATCAGCTGAGCTTGATATG
CCATTTTATGAAGATAAATCAGGAATGTCCAAGTACTTTGAAACATCTGCCTTGAAAGAAGAAGCAACAA
AAAGCATTGAGCCAGGCAGTGATTACTATGAACTGAGTGACACTAGAGAAAGTGTCCATGAGTCTATTGA
TACCATGTCTCCCATGCATAAAAATGGTGACAAGGAGTTTCAAACAGGAAAAGAATCCCAGCCCAGTCCT
CCAGCACAAGAAGCAGGGTACAGCACTCTCGCACAGAGTTATCCATCAGATTTACCTGAAGAACCCAGTT
CTCCTCAAGAAAGAATGTTCACTATTGATCCAAAAGTGTATGGAGAGAAAAGGGACCTCCACAGTAAGAA
TAAGGATGATTTGACCCTTAGCAGGAGTTTAGGACTTGGTGGTAGGTCTGCAATAGAACAAAGAAGCATG
TCAATCAATTTGCCGATGTCTTGCCTAGATTCCATAGCCCTTGGATTTAACTTTGGTCGGGGACATGATC
TTTCTCCTCTGGCTTCCGATATTCTAACCAACACTAGTGGAAGTATGGATGAAGGGGATGATTACCTTCC
AGCCACCACACCTGCACTGGAGAAAGCCCCTTGCTTCCCTGTAGAAAGCAAAGAGGAAGAACAGATAGAG
AAAGTAAAAGCTACTGGAGAAGAAAGTACTCAAGCGGAGATATCATGTGAGTCTCCTTTCCTAGCCAAAG
ATTTTTACAAAAATGGTACTGTCATGGCACCTGACCTTCCTGAAATGCTAGATCTGGCAGGCACAAGGTC
AAGATTGGCTTCTGTGAGTGCAGATGCTGAGGTTGCCAGGAGGAAATCAGTCCCATCAGAGACTGTGGTT
GAGGATAGTCGTACTGGCTTGCCCCCGGTAACTGATGAAAACCATGTCATTGTAAAAACGGACAGTCAGC
TCGAAGACCTGGGCTACTGTGTGTTCAATAAGTACACAGTCCCATTGCCATCACCTGTTCAAGACAGTGA
GAATTTATCAGGGGAGAGTGGTACCTTTTACGAAGGCACTGATGATAAAGTTCGAAGAGATTTGGCCACA
GACCTTTCACTGATTGAAGTGAAACTGGCAGCAGCCGGAAGAGTCAAAGATGAGTTCAGTGTTGACAAAG
AAGCATCCGCGCATATCTCTGGTGACAAATCAGGACTGAGTAAGGAGTTTGACCAAGAGAAGAAAGCTAA
TGATAGGTTGGATACTGTACTAGAAAAGAGTGAAGAACATGCTGATTCAAAAGAACATGCCAAGAAAACT
GAAGAGGCTGGTGATGAAATAGAAACATTCGGATTAGGAGTAACCTATGAGCAAGCTTTGGCCAAAGATT
TGTCAATACCAACAGATGCATCCTCTGAGAAAGCAGAGAAGGGTCTTAGTTCAGTTCCAGAGATAGCTGA
GGTAGAACCATCCAAAAAGGTGGAACAAGGTCTGGATTTTGCTGTCCAGGGTCAACTAGATGTTAAAATT
AGTGACTTTGGACAGATGGCTTCAGGGCTAAACATAGATGATAGAAGGGCAACAGAGCTAAAACTTGAGG
CTACACAGGACATGACCCCCTCATCCAAAGCACCGCAGGAGGCAGATGCATTTATGGGTGTTGAGTCTGG
CCACATGAAAGAAGGCACTAAAGTTAGTGAGACAGAAGTCAAACAGAAGGTGGCCAAGCCTGACTTGGTG
CACCAGGAGGCTGTAGACAAGGAGGAGTCCTATGAATCTAGTGGTGAGCATGAAAGTCTCACCATGGAGT
CCTTGAAAGCTGATGAGGGCAAGAAGGAAACATCTCCAGAATCATCTCTAATTCAAGATGAGATTGCCGT
CAAATTGTCAGTGGAAATACCTTGCCCACCTGCTGTTTCAGAGGCTGATTTAGCCACAGATGAGAGAGCT
GATGTCCAGATGGAATTTATTCAGGGGCCAAAAGAAGAAAGCAAAGAGACCCCAGATATATCCATCACGC
CTTCTGATGTTGCAGAGCCATTGCATGAAACGATCGTATCTGAACCAGCAGAGATTCAGAGTGAGGAAGA
AGAGATAGAAGCCCAGGGAGAATATGATAAACTGCTCTTCCGCTCAGACACCCTTCAGATAACTGACCTG
GGTGTCTCAGGTGCCAGGGAGGAATTTGTGGAGACCTGCCCAAGTGAACACAAAGGAGTGATTGAGTCTG
TTGTGACCATCGAGGATGATTTCATCACTGTAGTGCAAACCACAACTGATGAAGGGGAGTCAGGGTCCCA
CAGCGTGCGTTTTGCAGCCCTAGAGCAGCCTGAGGTGGAAAGGAGACCATCTCCTCATGATGAAGAAGAG
TTTGAAGTAGAAGAGGCAGCTGAAGCCCAGGCAGAACCCAAAGATGGTTCCCCAGAGGCTCCAGCTTCCC
CTGAGAGAGAAGAGGTTGCACTTTCTGAATATAAGACAGAAACCTATGACGATTACAAAGATGAGACCAC
CATTGACGACTCCATCATGGACGCTGACAGCCTCTGGGTGGACACTCAAGATGATGATAGGAGCATCATG
ACAGAACAGTTAGAAACTATTCCTAAAGAGGAGAAAGCTGAAAAGGAAGCTCGGAGATCATCTCTTGAGA
AACATAGAAAAGAAAAGCCTTTTAAAACCGGGAGAGGCAGAATTTCCACTCCTGAAAGAAAAGTAGCTAA
AAAGGAACCTAGCACAGTCTCCAGAGATGAAGTGAGAAGGAAAAAAGCAGTTTATAAGAAGGCTGAACTT
GCTAAAAAAACAGAAGTTCAGGCCCACTCTCCCTCCAGGAAATTCATTTTAAAACCTGCTATCAAATATA
CTAGACCAACTCATCTCTCCTGTGTTAAGCGGAAAACCACAGCAGCAGGTGGGGAATCAGCTCTGGCTCC
CAGTGTATTTAAACAGGCAAAGGACAAAGTCTCTGACGGAGTAACCAAGAGCCCAGAAAAGCGCTCTTCT
CTCCCAAGACCTTCCTCCATTCTCCCTCCTCGGCGAGGTGTGTCAGGAGACAGAGATGAGAATTCCTTCT
CTCTCAACAGTTCTATCTCTTCTTCAGCACGGCGGACCACCAGGTCAGAGCCAATTCGCAGAGCAGGGAA
GAGTGGTACCTCAACACCCACTACCCCTGGGTCTACTGCCATCACTCCTGGCACCCCACCAAGTTATTCT
TCACGCACACCAGGCACTCCTGGAACCCCTAGCTATCCCAGGACCCCTCACACACCAGGAACCCCCAAGT
CTGCCATCTTGGTGCCGAGTGAGAAGAAGGTCGCCATCATACGTACTCCTCCAAAATCTCCTGCGACTCC
CAAGCAGCTTCGGCTTATTAACCAACCACTGCCAGACCTGAAGAATGTCAAATCCAAAATCGGATCAACA
GACAACATCAAATACCAGCCTAAAGGGGGGCAGGTACAAATTGTTACCAAGAAAATAGACCTAAGCCATG
TGACATCCAAATGTGGCTCTCTGAAGAACATCGGCCACAGGCCAGGTGGCGGACGTGTGAAAATTGAGAG
TGTAAAACTAGATTTCAAAGAAAAGGCCCAAGCTAAAGTTGGTTCTCTTGATAATGCTCATCATGTACCT
GGAGGTGGTAATGTCAAGATTGACAGCCAAAAGTTGAACTTCAGAGAGCATGCTAAAGCCCGTGTGGACC
ATGGGGCTGAGATCATTACACAGTCCCCAGGCAGATCCAGCGTGGCATCACCCCGACGACTCAGCAATGT
CTCCTCGTCTGGAAGCATCAACCTGCTCGAATCTCCTCAGCTTGCCACTTTGGCTGAGGATGTCACTGCT
GCACTCGCTAAGCAGGGCTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216775 representing NM_002374
Red=Cloning site Green=Tags(s)

MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNT
KENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPS
PASEQTVTVEEDLLTASKMEFHDQQELTPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQPETTKTYPDK
KDMQGTEEEKAPLALFGHTLVASLEDMKQKTEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGL
VAPISPGPLTPMREKDVFDDIPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDK
KSLQQTSGPATAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETV
QQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHTFSEQKDQEPT
TDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMRVDDKDKIEGVGAATSAELDM
PFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRESVHESIDTMSPMHKNGDKEFQTGKESQPSP
PAQEAGYSTLAQSYPSDLPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSM
SINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPVESKEEEQIE
KVKATGEESTQAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVV
EDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGTDDKVRRDLAT
DLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRLDTVLEKSEEHADSKEHAKKT
EEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLSSVPEIAEVEPSKKVEQGLDFAVQGQLDVKI
SDFGQMASGLNIDDRRATELKLEATQDMTPSSKAPQEADAFMGVESGHMKEGTKVSETEVKQKVAKPDLV
HQEAVDKEESYESSGEHESLTMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERA
DVQMEFIQGPKEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVERRPSPHDEEE
FEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSIM
TEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAEL
AKKTEVQAHSPSRKFILKPAIKYTRPTHLSCVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSS
LPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYS
SRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGST
DNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIGHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVP
GGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTA
ALAKQGL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002374
ORF Size 5481 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002374.2, NP_002365.2
RefSeq Size 6534 bp
RefSeq ORF 5484 bp
Locus ID 4133
Cytogenetics 2q34
Domains tubulin-binding
Protein Families Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS
MW 199.3 kDa
Gene Summary This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2010]

Other Versions

Other products for "MAP2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Chicken Polyclonal MAP2 Antibody
    • 50 ul

USD 435.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools