ICAM2 (NM_001099788) Human Tagged ORF Clone

SKU
RC216706
ICAM2 (Myc-DDK-tagged)-Human intercellular adhesion molecule 2 (ICAM2), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ICAM2
Synonyms CD102
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216706 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCTTTCGGTTACAGGACCCTGACTGTGGCCCTCTTCACCCTGATCTGCTGTCCAGGATCGGATG
AGAAGGTATTCGAGGTACACGTGAGGCCAAAGAAGCTGGCGGTTGAGCCCAAAGGGTCCCTCGAGGTCAA
CTGCAGCACCACCTGTAACCAGCCTGAAGTGGGTGGTCTGGAGACCTCTCTAGATAAGATTCTGCTGGAC
GAACAGGCTCAGTGGAAACATTACTTGGTCTCAAACATCTCCCATGACACGGTCCTCCAATGCCACTTCA
CCTGCTCCGGGAAGCAGGAGTCAATGAATTCCAACGTCAGCGTGTACCAGCCTCCAAGGCAGGTCATCCT
GACACTGCAACCCACTTTGGTGGCTGTGGGCAAGTCCTTCACCATTGAGTGCAGGGTGCCCACCGTGGAG
CCCCTGGACAGCCTCACCCTCTTCCTGTTCCGTGGCAATGAGACTCTGCACTATGAGACCTTCGGGAAGG
CAGCCCCTGCTCCGCAGGAGGCCACAGCCACATTCAACAGCACGGCTGACAGAGAGGATGGCCACCGCAA
CTTCTCCTGCCTGGCTGTGCTGGACTTGATGTCTCGCGGTGGCAACATCTTTCACAAACACTCAGCCCCG
AAGATGTTGGAGATCTATGAGCCTGTGTCGGACAGCCAGATGGTCATCATAGTCACGGTGGTGTCGGTGT
TGCTGTCCCTGTTCGTGACATCTGTCCTGCTCTGCTTCATCTTCGGCCAGCACTTGCGCCAGCAGCGGAT
GGGCACCTACGGGGTGCGAGCGGCTTGGAGGAGGCTGCCCCAGGCCTTCCGGCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216706 protein sequence
Red=Cloning site Green=Tags(s)

MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD
EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE
PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP
KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001099788
ORF Size 825 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001099788.1, NP_001093258.1
RefSeq Size 1235 bp
RefSeq ORF 828 bp
Locus ID 3384
UniProt ID P13598
Cytogenetics 17q23.3
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Natural killer cell mediated cytotoxicity
MW 30.7 kDa
Summary The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ICAM2 (NM_001099788) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216706L3 Lenti-ORF clone of ICAM2 (Myc-DDK-tagged)-Human intercellular adhesion molecule 2 (ICAM2), transcript variant 3 10 ug
$600.00
RC216706L4 Lenti-ORF clone of ICAM2 (mGFP-tagged)-Human intercellular adhesion molecule 2 (ICAM2), transcript variant 3 10 ug
$600.00
RG216706 ICAM2 (tGFP-tagged) - Human intercellular adhesion molecule 2 (ICAM2), transcript variant 3 10 ug
$500.00
SC316703 ICAM2 (untagged)-Human intercellular adhesion molecule 2 (ICAM2), transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.