KCNIP4 (NM_147182) Human Tagged ORF Clone

SKU
RC216528
KCNIP4 (Myc-DDK-tagged)-Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KCNIP4
Synonyms CALP; KCHIP4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216528 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGTGAGGAGGGTGGAAAGCATTTCGGCTCAGCTGGAGGAGGCCAGCTCTACAGGCGGTTTCCTGT
ACGCTCAGAACAGCACCAAGCGCAGCATTAAAGAGCGGCTCATGAAGCTCTTGCCCTGCTCAGCTGCCAA
AACGTCGTCTCCTGCTATTCAAAACAGCGTGGAAGATGAACTGGAGATGGCCACCGTCAGGCATCGGCCC
GAAGCCCTTGAGCTTCTGGAAGCCCAGAGCAAATTTACCAAGAAAGAGCTTCAGATCCTTTACAGAGGAT
TTAAGAACGAATGCCCCAGTGGTGTTGTTAATGAAGAAACCTTCAAAGAGATTTACTCGCAGTTCTTTCC
ACAGGGAGACTCTACAACATATGCACATTTTCTGTTCAATGCATTTGATACAGACCACAATGGAGCTGTG
AGTTTCGAGGATTTCATCAAAGGTCTTTCCATTTTGCTCCGGGGGACAGTACAAGAAAAACTCAATTGGG
CATTTAATCTGTATGACATAAATAAAGATGGCTACATCACTAAAGAGGAAATGCTTGATATAATGAAAGC
AATATACGATATGATGGGTAAATGTACATATCCTGTCCTCAAAGAAGATGCTCCCAGACAACACGTTGAA
ACATTTTTTCAGAAAATGGACAAAAATAAAGATGGGGTTGTTACCATAGATGAGTTCATTGAAAGCTGCC
AAAAAGATGAAAACATAATGCGCTCCATGCAGCTCTTTGAAAATGTGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216528 protein sequence
Red=Cloning site Green=Tags(s)

MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP
EALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAV
SFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVE
TFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_147182
ORF Size 750 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 2371 bp
RefSeq ORF 567 bp
Locus ID 80333
UniProt ID Q6PIL6
Cytogenetics 4p15.31-p15.2
Protein Families Druggable Genome, Ion Channels: Other
MW 28.7 kDa
Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:KCNIP4 (NM_147182) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216528L3 Lenti ORF clone of Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC216528L4 Lenti ORF clone of Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3, mGFP tagged 10 ug
$600.00
RG216528 KCNIP4 (tGFP-tagged) - Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3 10 ug
$500.00
SC306302 KCNIP4 (untagged)-Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.