NCF4 (NM_000631) Human Tagged ORF Clone

SKU
RC216094
NCF4 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NCF4
Synonyms CGD3; NCF; P40PHOX; SH3PXD4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216094 representing NM_000631
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGCCCAGCAGCTGCGGGCCGAGAGTGACTTTGAACAGCTTCCGGATGATGTTGCCATCTCGG
CCAACATTGCTGACATCGAGGAGAAGAGAGGCTTCACCAGCCACTTTGTTTTCGTCATCGAGGTGAAGAC
AAAAGGAGGATCCAAGTACCTCATCTACCGCCGCTACCGCCAGTTCCATGCTTTGCAGAGCAAGCTGGAG
GAGCGCTTCGGGCCAGACAGCAAGAGCAGTGCCCTGGCCTGTACCCTGCCCACACTCCCAGCCAAAGTCT
ACGTGGGTGTGAAACAGGAGATCGCCGAGATGCGGATACCTGCCCTCAACGCCTACATGAAGAGCCTGCT
CAGCCTGCCGGTCTGGGTGCTGATGGATGAGGACGTCCGGATCTTCTTTTACCAGTCGCCCTATGACTCA
GAGCAGGTGCCCCAGGCACTCCGCCGGCTCCGCCCGCGCACCCGGAAAGTCAAGAGCGTGTCCCCACAGG
GCAACAGCGTTGACCGCATGGCAGCTCCGAGAGCAGAGGCTCTATTTGACTTCACTGGAAACAGCAAACT
GGAGCTGAATTTCAAAGCTGGAGATGTGATCTTCCTCCTCAGTCGGATCAACAAAGACTGGCTGGAGGGC
ACTGTCCGGGGAGCCACGGGCATCTTCCCTCTCTCCTTCGTGAAGATCCTCAAAGACTTCCCTGAGGAGG
ACGACCCCACCAACTGGCTGCGTTGCTACTACTACGAAGACACCATCAGCACCATCAAGGACATCGCGGT
GGAGGAAGATCTCAGCAGCACTCCCCTATTGAAAGACCTGCTGGAGCTCACAAGGCGGGAGTTCCAGAGA
GAGGACATAGCTCTGAATTACCGGGACGCTGAGGGGGATCTGGTTCGGCTGCTGTCGGATGAGGACGTAG
CGCTCATGGTGCGGCAGGCTCGTGGCCTCCCCTCCCAGAAGCGCCTCTTCCCCTGGAAGCTGCACATCAC
GCAGAAGGACAACTACAGGGTCTACAACACGATGCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216094 representing NM_000631
Red=Cloning site Green=Tags(s)

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE
ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS
EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG
TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR
EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000631
ORF Size 1017 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000631.5
RefSeq Size 1386 bp
RefSeq ORF 1020 bp
Locus ID 4689
UniProt ID Q15080
Cytogenetics 22q12.3
Domains PB1, PX, SH3
Protein Pathways Leukocyte transendothelial migration
MW 38.9 kDa
Summary The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NCF4 (NM_000631) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216094L1 Lenti ORF clone of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC216094L2 Lenti ORF clone of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, mGFP tagged 10 ug
$757.00
RC216094L3 Lenti ORF clone of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC216094L4 Lenti ORF clone of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, mGFP tagged 10 ug
$757.00
RG216094 NCF4 (tGFP-tagged) - Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC119769 NCF4 (untagged)-Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.