Semaphorin 3D (SEMA3D) (NM_152754) Human Tagged ORF Clone

CAT#: RC216032

Reviews ()
Write a review

SEMA3D (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D (SEMA3D)



Reconstitution Protocol

USD 711.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SEMA3D"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEMA3D
Synonyms coll-2; Sema-Z2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216032 representing NM_152754
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGCTAATAAAGATGAAAGACTTAAAGCCAGAAGCCAAGATTTTCACCTTTTTCCTGCTTTGATGA
TGCTAAGCATGACCATGTTGTTTCTTCCAGTCACTGGCACTTTGAAGCAAAATATTCCAAGACTCAAGCT
AACCTACAAAGACTTGCTGCTTTCAAATAGCTGTATTCCCTTTTTGGGTTCATCAGAAGGACTGGATTTT
CAAACTCTTCTCTTAGATGAGGAAAGAGGCAGGCTGCTCTTGGGAGCCAAAGACCACATCTTTCTACTCA
GTCTGGTTGACTTAAACAAAAATTTTAAGAAGATTTATTGGCCTGCTGCAAAGGAACGGGTGGAATTATG
TAAATTAGCTGGGAAAGATGCCAATACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAA
ACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACA
AGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCC
TCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGC
AAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAG
AGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGA
TGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCT
CGAGTTGGAAGAGTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTC
TTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGA
TATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACTACAACCAGCTCC
ATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATG
CTCATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTAC
ATGTCCAAGCAAAACCTATGACCCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTC
ATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGAGGACCAACGTTCAAGAGAATCA
ATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTAAT
GTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAA
GAGGTAGTGCTGGAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGA
AGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTA
TGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGAAATGCATGCTCT
CGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGT
GCTGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAA
CTCAACCTTTCTGGAATGTATACCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGG
GATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACGGAATATGGGCTACTGATTCGAA
GTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATAGT
GAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGG
AAGGTCAAGGATCTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAA
ACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGG
CCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGAGACCTGGATGAG
CTCCCTAGAGCTGTAGCCACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216032 representing NM_152754
Red=Cloning site Green=Tags(s)

MNANKDERLKARSQDFHLFPALMMLSMTMLFLPVTGTLKQNIPRLKLTYKDLLLSNSCIPFLGSSEGLDF
QTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLAGKDANTECANFIRVLQPYNK
THIYVCGTGAFHPICGYIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMTDEYLYSGTASDFLG
KDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILS
RVGRVCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSS
IFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHSVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDVMFLGTDIGTVLKVVSISKEKWNME
EVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKACADCCLARDPYCAWDGNACS
RYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQATIKWYIQRSG
DEHREELKPDERIIKTEYGLLIRSLQKKDSGMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEG
KVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDE
LPRAVAT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_152754
ORF Size 2331 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_152754.2, NP_689967.2
RefSeq Size 6276 bp
RefSeq ORF 2334 bp
Locus ID 223117
UniProt ID O95025
Cytogenetics 7q21.11
Domains IG, PSI
Protein Families Transmembrane
Protein Pathways Axon guidance
MW 89.5 kDa
Gene Summary This gene encodes a member of the semaphorin III family of secreted signaling proteins that are involved in axon guidance during neuronal development. The encoded protein contains an N-terminal Sema domain, an immunoglobulin like domain and a C-terminal basic domain. The protein encoded by this gene binds neuropilin and plays an important role in cardiovascular development. [provided by RefSeq, Aug 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.