Histone H2A Bbd (H2AFB1) (NM_001017990) Human Tagged ORF Clone

SKU
RC216020
H2AFB1 (Myc-DDK-tagged)-Human H2A histone family, member B1 (H2AFB1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Histone H2A Bbd
Synonyms H2A.B; H2A.Bbd; H2AFB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216020 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAGGAGGAGGAGACGCCGAGGGTCCTCCGGTGCTGGCGGCCGGGGGCGGACCTGCTCTCGCACCG
TCCGAGCGGAGCTTTCGTTTTCAGTGAGCCAGGTGGAGCGCAGTCTACGGGAGGGCCACTACGCTCAGCG
CCTGAGTCGCACGGCGCCGGTCTACCTCGCTGCGGTTATTGAGTACCTGACGGCCAAGGTCCTGGAGCTG
GCGGGCAACGAGGCCCAGAACAGCGGAGAGCGGAACATCACTCCCCTGCTGCTGGACATGGTGGTTCACA
ACGACAGGCTACTGAGCACCCTTTTCAACACGACCACCATCTCTCAAGTGGCCCCTGGCGAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216020 protein sequence
Red=Cloning site Green=Tags(s)

MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL
AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001017990
ORF Size 345 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001017990.1, NP_001017990.1
RefSeq Size 517 bp
RefSeq ORF 348 bp
Locus ID 474382
UniProt ID P0C5Y9
Cytogenetics Xq28
Protein Pathways Systemic lupus erythematosus
MW 12.7 kDa
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the most centromeric copy which is in intron 22 of the F8 gene. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:Histone H2A Bbd (H2AFB1) (NM_001017990) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216020L3 Lenti ORF clone of Human H2A histone family, member B1 (H2AFB1), Myc-DDK-tagged 10 ug
$450.00
RC216020L4 Lenti ORF clone of Human H2A histone family, member B1 (H2AFB1), mGFP tagged 10 ug
$450.00
RG216020 H2AFB1 (tGFP-tagged) - Human H2A histone family, member B1 (H2AFB1) 10 ug
$350.00
SC302109 H2AFB1 (untagged)-Human H2A histone family, member B1 (H2AFB1) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.