SEC14 like protein 2 (SEC14L2) (NM_012429) Human Tagged ORF Clone

CAT#: RC215994

Reviews ()
Write a review

SEC14L2 (Myc-DDK-tagged)-Human SEC14-like 2 (S. cerevisiae) (SEC14L2), transcript variant 1



  "NM_012429" in other vectors (6)

Reconstitution Protocol

USD 686.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "SEC14L2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEC14L2
Synonyms C22orf6; SPF; TAP; TAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215994 representing NM_012429
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGGCAGAGTCGGCGATCTGAGCCCCAGGCAGAAGGAGGCATTGGCCAAGTTTCGGGAGAATGTCC
AGGATGTGCTGCCGGCCCTGCCGAATCCAGATGACTATTTTCTCCTGCGTTGGCTCCGAGCCAGAAGCTT
CGACCTGCAGAAGTCGGAGGCCATGCTCCGGAAGCATGTGGAGTTCCGAAAGCAAAAGGACATTGACAAC
ATCATTAGCTGGCAGCCTCCAGAGGTGATCCAACAGTATCTGTCAGGGGGTATGTGTGGCTATGACCTGG
ATGGCTGCCCAGTCTGGTACGACATAATTGGACCTCTGGATGCCAAGGGTCTGCTGTTCTCAGCCTCCAA
ACAGGACCTGCTGAGGACCAAGATGCGGGAGTGTGAGCTGCTTCTGCAAGAGTGTGCCCACCAGACCACA
AAGTTGGGGAGGAAGGTGGAGACCATCACCATAATTTATGACTGCGAGGGGCTTGGCCTCAAGCATCTCT
GGAAGCCTGCTGTGGAGGCCTATGGAGAGTTTCTCTGCATGTTTGAGGAAAATTATCCCGAAACACTGAA
GCGTCTTTTTGTTGTTAAAGCCCCCAAACTGTTTCCTGTGGCCTATAACCTCATCAAACCCTTCCTGAGT
GAGGACACTCGTAAGAAGATCATGGTCCTGGGAGCAAATTGGAAGGAGGTTTTACTGAAACATATCAGCC
CTGACCAGGTGCCTGTGGAGTATGGGGGCACCATGACTGACCCTGATGGAAACCCCAAGTGCAAATCCAA
GATCAACTACGGGGGTGACATCCCCAGGAAGTATTATGTGCGAGACCAGGTGAAACAGCAGTATGAACAC
AGCGTGCAGATTTCCCGTGGCTCCTCCCACCAAGTGGAGTATGAGATCCTCTTCCCTGGCTGTGTCCTCA
GGTGGCAGTTTATGTCAGATGGAGCGGATGTTGGTTTTGGGATTTTCCTGAAGACCAAGATGGGAGAGAG
GCAGCGGGCAGGGGAGATGACAGAGGTGCTGCCCAACCAGAGGTACAACTCCCACCTGGTCCCTGAAGAT
GGGACCCTCACCTGCAGTGATCCTGGCATCTATGTCCTGCGGTTTGACAACACCTACAGCTTCATTCATG
CCAAGAAGGTCAATTTCACTGTGGAGGTCCTGCTTCCAGACAAAGCCTCAGAAGAGAAGATGAAACAGCT
GGGGGCAGGCACCCCGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215994 representing NM_012429
Red=Cloning site Green=Tags(s)

MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDN
IISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTT
KLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLS
EDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEH
SVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPED
GTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012429
ORF Size 1209 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012429.5
RefSeq Size 2818 bp
RefSeq ORF 1212 bp
Locus ID 23541
UniProt ID O76054
Cytogenetics 22q12.2
Domains SEC14
Protein Families Transcription Factors
MW 46 kDa
Gene Summary This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.