GATC (NM_176818) Human Tagged ORF Clone

SKU
RC215964
GATC (Myc-DDK-tagged)-Human glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial) (GATC), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GATC
Synonyms 15E1.2; COXPD42
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215964 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGTCGCGGTTGGTGTGGCTGGGCCTTCGGGCCCCTCTGGGCGGGCGCCAGGGCTTCACCTCCAAGG
CGGATCCTCAGGGCAGTGGCCGGATCACGGCTGCGGTGATCGAGCACCTGGAGCGTCTAGCGCTTGTGGA
CTTCGGCAGCCGCGAGGCAGTGGCGCGACTGGAGAAAGCTATCGCCTTCGCCGACCGGCTACGCGCCGTG
GACACAGACGGGGTGGAGCCCATGGAATCGGTCCTGGAGGACAGATGTCTATACCTGAGATCCGACAATG
TGGTAGAAGGCAACTGTGCTGATGAATTACTACAAAACTCCCATCGCGTCGTGGAGGAGTACTTTGTGGC
CCCCCCAGGTAATATCTCTTTGCCAAAGCTGGATGAACAAGAGCCATTCCCACACAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215964 protein sequence
Red=Cloning site Green=Tags(s)

MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAV
DTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_176818
ORF Size 410 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_176818.3
RefSeq Size 4248 bp
RefSeq ORF 411 bp
Locus ID 283459
UniProt ID O43716
Cytogenetics 12q24.31
MW 15.1 kDa
Summary Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:GATC (NM_176818) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215964L3 Lenti ORF clone of Human glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial) (GATC), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC215964L4 Lenti ORF clone of Human glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial) (GATC), transcript variant 1, mGFP tagged 10 ug
$450.00
RG215964 GATC (tGFP-tagged) - Human glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial) (GATC), transcript variant 1 10 ug
$489.00
SC307070 GATC (untagged)-Human glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial) (GATC), transcript variant 1 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.