BHLHA15 (NM_177455) Human Tagged ORF Clone

SKU
RC215938
BHLHA15 (Myc-DDK-tagged)-Human basic helix-loop-helix family, member a15 (BHLHA15)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BHLHA15
Synonyms BHLHB8; MIST1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215938 representing NM_177455
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACCAAGAACCGGCCCCCACGGCGCCGGGCCCCGGTGCAGGACACAGAGGCCACCCCCGGGGAGG
GGACGCCCGACGGGTCCCTGCCGAACCCGGGGCCAGAGCCGGCCAAGGGTCTGCGGAGCCGGCCGGCCCG
GGCCGCAGCAAGGGCTCCGGGCGAGGGCAGGCGCAGGCGGCCAGGACCCTCCGGGCCCGGTGGCCGTCGT
GACAGCAGCATCCAGCGGCGGCTGGAGAGCAACGAGAGGGAGCGGCAGCGGATGCACAAGCTAAATAACG
CCTTCCAGGCCCTGCGTGAAGTCATCCCCCACGTGCGCGCGGACAAGAAGCTCTCCAAGATCGAGACGCT
CACGCTGGCCAAGAACTACATCAAATCGCTGACGGCCACCATCCTGACCATGTCCAGCAGCCGCCTCCCA
GGCCTGGAGGGGCCGGGCCCCAAGCTCTACCAGCACTACCAGCAGCAGCAGCAGGTGGCTGGGGGTGCGT
TGGGGGCCACGGAGGCCCAGCCCCAGGGCCACCTGCAGAGGTACTCCACGCAGATCCACAGCTTCCGAGA
GGGCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215938 representing NM_177455
Red=Cloning site Green=Tags(s)

MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRRPGPSGPGGRR
DSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLP
GLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREGT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_177455
ORF Size 567 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177455.4
RefSeq Size 588 bp
RefSeq ORF 570 bp
Locus ID 168620
UniProt ID Q7RTS1
Cytogenetics 7q21.3
Protein Pathways Maturity onset diabetes of the young
MW 20.6 kDa
Summary Plays a role in controlling the transcriptional activity of MYOD1, ensuring that expanding myoblast populations remain undifferentiated. Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3' (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:BHLHA15 (NM_177455) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215938L3 Lenti ORF clone of Human basic helix-loop-helix family, member a15 (BHLHA15), Myc-DDK-tagged 10 ug
$750.00
RC215938L4 Lenti ORF clone of Human basic helix-loop-helix family, member a15 (BHLHA15), mGFP tagged 10 ug
$750.00
RG215938 BHLHA15 (tGFP-tagged) - Human basic helix-loop-helix family, member a15 (BHLHA15) 10 ug
$650.00
SC307095 BHLHA15 (untagged)-Human basic helix-loop-helix family, member a15 (BHLHA15) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.