ANP32C (NM_012403) Human Tagged ORF Clone

SKU
RC215880
ANP32C (Myc-DDK-tagged)-Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member C (ANP32C)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ANP32C
Synonyms PP32R1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215880 representing NM_012403
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGATGGGCAGACGGATTCATTCAGAGCTGCGGAACAGGGCGCCCTCTGATGTGAAAGAACTTGCCC
TGGACAACAGTCGGTCGAATGAAGGCAAACTCGAAGCCCTCACAGATGAATTTGAAGAACTGGAATTCTT
AAGTAAAATCAACGGAGGCCTCACCTCAATCTCAGACTTACCAAAGTTAAAGTTGAGAAAGCTTGAACTA
AGAGTCTCAGGGGGCCTGGAAGTATTGGCAGAAAAGTGTCCAAACCTCACGCATCTATATTTAAGTGGCA
ACAAAATTAAAGACCTCAGCACAATAGAGCCACTGAAACAGTTAGAAAACCTCAAGAGCTTAGACCTTTT
CAATTGCGAGGTAACCAACCTGAACGACTACGGAGAAAACGTGTTCAAGCTTCTCCTGCAACTCACATAT
CTCGACAGCTGTTACTGGGACCACAAGGAGGCCCCTTACTCAGATATTGAGGACCACGTGGAGGGCCTGG
ATGACGAGGAGGAGGGTGAGCATGAGGAGGAGTATGATGAAGATGCTCAGGTAGTGGAAGATGAGGAGGG
CGAGGAGGAGGAGGAGGAAGGTGAAGAGGAGGACGTGAGTGGAGGGGACGAGGAGGATGAAGAAGGTTAT
AACGATGGAGAGGTAGATGGCGAGGAAGATGAAGAAGAGCTTGGTGAAGAAGAAAGGGGTCAGAAGCGAA
AA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215880 representing NM_012403
Red=Cloning site Green=Tags(s)

MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLEL
RVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTY
LDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGY
NDGEVDGEEDEEELGEEERGQKRK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012403
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012403.1, NP_036535.1
RefSeq Size 705 bp
RefSeq ORF 705 bp
Locus ID 23520
UniProt ID O43423
Cytogenetics 4q32.3
MW 26.6 kDa
Summary Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ANP32C (NM_012403) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215880L3 Lenti ORF clone of Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member C (ANP32C), Myc-DDK-tagged 10 ug
$600.00
RC215880L4 Lenti ORF clone of Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member C (ANP32C), mGFP tagged 10 ug
$600.00
RG215880 ANP32C (tGFP-tagged) - Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member C (ANP32C) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC303976 ANP32C (untagged)-Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member C (ANP32C) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.