FGF12 (NM_021032) Human Tagged ORF Clone

SKU
RC215868
FGF12 (Myc-DDK-tagged)-Human fibroblast growth factor 12 (FGF12), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FGF12
Synonyms DEE47; EIEE47; FGF12B; FHF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215868 representing NM_021032
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCGGCGATAGCCAGCTCCTTGATCCGGCAGAAGCGGCAGGCGAGGGAGTCCAACAGCGACCGAG
TGTCGGCCTCCAAGCGCCGCTCCAGCCCCAGCAAAGACGGGCGCTCCCTGTGCGAGAGGCACGTCCTCGG
GGTGTTCAGCAAAGTGCGCTTCTGCAGCGGCCGCAAGAGGCCGGTGAGGCGGAGACCAGAACCCCAGCTC
AAAGGGATTGTGACAAGGTTATTCAGCCAGCAGGGATACTTCCTGCAGATGCACCCAGATGGTACCATTG
ATGGGACCAAGGACGAAAACAGCGACTACACTCTCTTCAATCTAATTCCCGTGGGCCTGCGTGTAGTGGC
CATCCAAGGAGTGAAGGCTAGCCTCTATGTGGCCATGAATGGTGAAGGCTATCTCTACAGTTCAGATGTT
TTCACTCCAGAATGCAAATTCAAGGAATCTGTGTTTGAAAACTACTATGTGATCTATTCTTCCACACTGT
ACCGCCAGCAAGAATCAGGCCGAGCTTGGTTTCTGGGACTCAATAAAGAAGGTCAAATTATGAAGGGGAA
CAGAGTGAAGAAAACCAAGCCCTCATCACATTTTGTACCGAAACCTATTGAAGTGTGTATGTACAGAGAA
CCATCGCTACATGAAATTGGAGAAAAACAAGGGCGTTCAAGGAAAAGTTCTGGAACACCAACCATGAATG
GAGGCAAAGTTGTGAATCAAGATTCAACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215868 representing NM_021032
Red=Cloning site Green=Tags(s)

MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQL
KGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDV
FTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYRE
PSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021032
ORF Size 729 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021032.5
RefSeq Size 2817 bp
RefSeq ORF 732 bp
Locus ID 2257
UniProt ID P61328
Cytogenetics 3q28-q29
Domains FGF
Protein Families Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
MW 27.2 kDa
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. [provided by RefSeq, Dec 2019]
Write Your Own Review
You're reviewing:FGF12 (NM_021032) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215868L1 Lenti ORF clone of Human fibroblast growth factor 12 (FGF12), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215868L2 Lenti ORF clone of Human fibroblast growth factor 12 (FGF12), transcript variant 1, mGFP tagged 10 ug
$600.00
RC215868L3 Lenti ORF clone of Human fibroblast growth factor 12 (FGF12), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215868L4 Lenti ORF clone of Human fibroblast growth factor 12 (FGF12), transcript variant 1, mGFP tagged 10 ug
$600.00
RG215868 FGF12 (tGFP-tagged) - Human fibroblast growth factor 12 (FGF12), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC113009 FGF12 (untagged)-Human fibroblast growth factor 12 (FGF12), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.