APOBEC1 (NM_001644) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC215744
APOBEC1 (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 (APOBEC1)
$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol APOBEC1
Synonyms APOBEC-1; BEDP; CDAR1; HEPR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215744 representing NM_001644
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTCTGAGAAAGGTCCTTCAACCGGTGACCCCACTCTGAGGAGAAGAATCGAACCCTGGGAGTTTG
ACGTCTTCTATGACCCCAGAGAACTTCGTAAAGAGGCCTGTCTGCTCTACGAAATCAAGTGGGGCATGAG
CCGGAAGATCTGGCGAAGCTCAGGCAAAAACACCACCAATCACGTGGAAGTTAATTTTATAAAAAAATTT
ACGTCAGAAAGAGATTTTCACCCATCCATCAGCTGCTCCATCACCTGGTTCTTGTCCTGGAGTCCCTGCT
GGGAATGCTCCCAGGCTATTAGAGAGTTTCTGAGTCGGCACCCTGGTGTGACTCTAGTGATCTACGTAGC
TCGGCTTTTTTGGCACATGGATCAACAAAATCGGCAAGGTCTCAGGGACCTTGTTAACAGTGGAGTAACT
ATTCAGATTATGAGAGCATCAGAGTATTATCACTGCTGGAGGAATTTTGTCAACTACCCACCTGGGGATG
AAGCTCACTGGCCACAATACCCACCTCTGTGGATGATGTTGTACGCACTGGAGCTGCACTGCATAATTCT
AAGTCTTCCACCCTGTTTAAAGATTTCAAGAAGATGGCAAAATCATCTTACATTTTTCAGACTTCATCTT
CAAAACTGCCATTACCAAACGATTCCGCCACACATCCTTTTAGCTACAGGGCTGATACATCCTTCTGTGG
CTTGGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215744 representing NM_001644
Red=Cloning site Green=Tags(s)

MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKF
TSERDFHPSISCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVT
IQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHL
QNCHYQTIPPHILLATGLIHPSVAWR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001644
ORF Size 708 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001644.2
RefSeq Size 911 bp
RefSeq ORF 711 bp
Locus ID 339
UniProt ID P41238
Cytogenetics 12p13.31
MW 28 kDa
Summary This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2015]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC215744L1 Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 (APOBEC1), Myc-DDK-tagged 10 ug
$750.00
RC215744L2 Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 (APOBEC1), mGFP tagged 10 ug
$750.00
RC215744L3 Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 (APOBEC1), Myc-DDK-tagged 10 ug
$750.00
RC215744L4 Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 (APOBEC1), mGFP tagged 10 ug
$750.00
RG215744 APOBEC1 (tGFP-tagged) - Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 (APOBEC1) 10 ug
$650.00
SC303051 APOBEC1 (untagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 (APOBEC1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.