mtTFA (TFAM) (NM_003201) Human Tagged ORF Clone

SKU
RC215488
TFAM (Myc-DDK-tagged)-Human transcription factor A, mitochondrial (TFAM), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol mtTFA
Synonyms MTDPS15; MTTF1; MTTFA; TCF6; TCF6L1; TCF6L2; TCF6L3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215488 representing NM_003201
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTTTCTCCGAAGCATGTGGGGCGTGCTGAGTGCCCTGGGAAGGTCTGGAGCAGAGCTGTGCACCG
GCTGTGGAAGTCGACTGCGCTCCCCCTTCAGTTTTGTGTATTTACCGAGGTGGTTTTCATCTGTCTTGGC
AAGTTGTCCAAAGAAACCTGTAAGTTCTTACCTTCGATTTTCTAAAGAACAACTACCCATATTTAAAGCT
CAGAACCCAGATGCAAAAACTACAGAACTAATTAGAAGAATTGCCCAGCGTTGGAGGGAACTTCCTGATT
CAAAGAAAAAAATATATCAAGATGCTTATAGGGCGGAGTGGCAGGTATATAAAGAAGAGATAAGCAGATT
TAAAGAACAGCTAACTCCAAGTCAGATTATGTCTTTGGAAAAAGAAATCATGGACAAACATTTAAAAAGG
AAAGCTATGACAAAAAAAAAAGAGTTAACACTGCTTGGAAAACCAAAAAGACCTCGTTCAGCTTATAACG
TTTATGTAGCTGAAAGATTCCAAGAAGCTAAGGGTGATTCACCGCAGGAAAAGCTGAAGACTGTAAAGGA
AAACTGGAAAAATCTGTCTGACTCTGAAAAGGAATTATATATTCAGCATGCTAAAGAGGACGAAACTCGT
TATCATAATGAAATGAAGTCTTGGGAAGAACAAATGATTGAAGTTGGACGAAAGGATCTTCTACGTCGCA
CAATAAAGAAACAACGAAAATATGGTGCTGAGGAGTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215488 representing NM_003201
Red=Cloning site Green=Tags(s)

MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKA
QNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKR
KAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETR
YHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003201
ORF Size 738 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003201.3
RefSeq Size 1936 bp
RefSeq ORF 741 bp
Locus ID 7019
UniProt ID Q00059
Cytogenetics 10q21.1
Domains HMG
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Huntington's disease
MW 29.1 kDa
Summary This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:mtTFA (TFAM) (NM_003201) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215488L1 Lenti ORF clone of Human transcription factor A, mitochondrial (TFAM), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$750.00
RC215488L2 Lenti ORF clone of Human transcription factor A, mitochondrial (TFAM), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$750.00
RC215488L3 Lenti ORF clone of Human transcription factor A, mitochondrial (TFAM), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$750.00
RC215488L4 Lenti ORF clone of Human transcription factor A, mitochondrial (TFAM), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$750.00
RG215488 TFAM (tGFP-tagged) - Human transcription factor A, mitochondrial (TFAM), nuclear gene encoding mitochondrial protein 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC118128 TFAM (untagged)-Human transcription factor A, mitochondrial (TFAM), nuclear gene encoding mitochondrial protein 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.