PSMF1 (NM_178578) Human Tagged ORF Clone

SKU
RC215482
PSMF1 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) inhibitor subunit 1 (PI31) (PSMF1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMF1
Synonyms PI31
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215482 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGCCTGGAGGTACTGTTCGCATCGGCAGCGCCGGCCATCACCTGCAGGCAGGACGCGCTCGTCT
GCTTCTTGCATTGGGAAGTGGTGACACACGGTTACTGCGGCTTGGGTGTCGGTGACCAGCCGGGTCCCAA
TGATAAGAAGTCAGAACTGCTGCCAGCTGGGTGGAACAACAATAAAGACCTGTATGTCCTCCGGTATGAG
TATAAGGATGGGTCCAGAAAGCTCCTTGTGAAAGCCATCACCGTGGAGAGCAGCATGATCCTCAATGTGC
TGGAATATGGCTCACAGCAAGTGGCAGACTTGACCCTGAACTTGGATGATTATATCGATGCAGAACACCT
GGGTGACTTCCACAGGACCTACAAGAACAGTGAGGAGCTTCGGTCTCGTATTGTGTCTGGAATCATCACA
CCTATCCATGAGCAGTGGGAAAAGGCTAATGTAAGCAGTCCCCACCGGGAGTTCCCCCCTGCTACCGCCA
GAGAGGTGGACCCACTCCGGATTCCTCCACACCACCCACACACCAGTCGGCAGCCTCCCTGGTGTGATCC
CCTGGGCCCGTTTGTTGTCGGGGGAGAAGACTTAGACCCTTTTGGGCCTCGGAGAGGTGGCATGATTGTG
GATCCCCTGAGATCTGGCTTCCCAAGAGCACTTATTGACCCTTCCTCAGGCCTCCCGAACCGACTTCCTC
CAGGCGCTGTGCCCCCAGGAGCTCGCTTTGACCCCTTTGGACCCATTGGGACCAGCCCACCCGGACCTAA
CCCAGACCATCTCCCCCCGCCGGGCTACGATGACATGTACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215482 protein sequence
Red=Cloning site Green=Tags(s)

MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYE
YKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIIT
PIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIV
DPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178578
ORF Size 813 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178578.1, NP_848693.1
RefSeq Size 3686 bp
RefSeq ORF 816 bp
Locus ID 9491
UniProt ID Q92530
Cytogenetics 20p13
Protein Pathways Proteasome
MW 29.8 kDa
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PSMF1 (NM_178578) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215482L3 Lenti ORF clone of Human proteasome (prosome, macropain) inhibitor subunit 1 (PI31) (PSMF1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC215482L4 Lenti ORF clone of Human proteasome (prosome, macropain) inhibitor subunit 1 (PI31) (PSMF1), transcript variant 2, mGFP tagged 10 ug
$600.00
RG215482 PSMF1 (tGFP-tagged) - Human proteasome (prosome, macropain) inhibitor subunit 1 (PI31) (PSMF1), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC312741 PSMF1 (untagged)-Human proteasome (prosome, macropain) inhibitor subunit 1 (PI31) (PSMF1), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.