IGFL1 (NM_198541) Human Tagged ORF Clone

SKU
RC215281
IGFL1 (Myc-DDK-tagged)-Human IGF-like family member 1 (IGFL1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IGFL1
Synonyms APRG644; UNQ644
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215281 representing NM_198541
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCCCGAGGCTGCATCGTAGCTGTCTTTGCCATTTTCTGCATCTCCAGGCTCCTCTGCTCACACG
GAGCCCCAGTGGCCCCCATGACTCCTTACCTGATGCTGTGCCAGCCACACAAGAGATGTGGGGACAAGTT
CTACGACCCCCTGCAGCACTGTTGCTATGATGATGCCGTCGTGCCCTTGGCCAGGACCCAGACGTGTGGA
AACTGCACCTTCAGAGTCTGCTTTGAGCAGTGCTGCCCCTGGACCTTCATGGTGAAGCTGATAAACCAGA
ACTGCGACTCAGCCCGGACCTCGGATGACAGGCTTTGTCGCAGTGTCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215281 representing NM_198541
Red=Cloning site Green=Tags(s)

MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG
NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198541
ORF Size 330 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198541.2
RefSeq Size 771 bp
RefSeq ORF 333 bp
Locus ID 374918
UniProt ID Q6UW32
Cytogenetics 19q13.32
Protein Families Secreted Protein, Transmembrane
MW 12.2 kDa
Summary The protein encoded by this gene is a member of the insulin-like growth factor family of signaling molecules. The encoded protein is synthesized as a precursor protein and is proteolytically cleaved to form a secreted mature peptide. The mature peptide binds to a receptor, which in mouse was found on the cell surface of T cells. Increased expression of this gene may be linked to psoriasis. [provided by RefSeq, Aug 2016]
Write Your Own Review
You're reviewing:IGFL1 (NM_198541) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215281L1 Lenti ORF clone of Human IGF-like family member 1 (IGFL1), Myc-DDK-tagged 10 ug
$450.00
RC215281L2 Lenti ORF clone of Human IGF-like family member 1 (IGFL1), mGFP tagged 10 ug
$450.00
RC215281L3 Lenti ORF clone of Human IGF-like family member 1 (IGFL1), Myc-DDK-tagged 10 ug
$450.00
RC215281L4 Lenti ORF clone of Human IGF-like family member 1 (IGFL1), mGFP tagged 10 ug
$450.00
RG215281 IGFL1 (tGFP-tagged) - Human IGF-like family member 1 (IGFL1) 10 ug
$489.00
SC107843 IGFL1 (untagged)-Human IGF-like family member 1 (IGFL1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.