CT45A1 (NM_001017417) Human Tagged ORF Clone

SKU
RC214947
CT45A1 (Myc-DDK-tagged)-Human cancer/testis antigen family 45, member A1 (CT45A1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CT45A1
Synonyms CT45; CT45-1; CT45.1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214947 representing NM_001017417
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGATAAAACAGAGAAGGTGGCTGTAGATCCTGAAACTGTGTTTAAACGTCCCAGGGAATGTGACA
GTCCTTCGTATCAGAAAAGGCAGAGGATGGCCCTGTTGGCAAGGAAACAAGGAGCAGGAGACAGCCTTAT
TGCAGGCTCTGCCATGTCCAAAGAAAAGAAGCTTATGACAGGACATGCTATTCCACCCAGCCAATTGGAT
TCTCAGATTGATGACTTCACTGGTTTCAGCAAAGATAGGATGATGCAGAAACCTGGTAGCAATGCACCTG
TGGGAGGAAACGTTACCAGCAGTTTCTCTGGAGATGACCTAGAATGCAGAGAAACAGCCTCCTCTCCCAA
AAGCCAACGAGAAATTAATGCTGATATAAAACGTAAATTAGTGAAGGAACTCCGATGCGTTGGACAAAAA
TATGAAAAAATCTTCGAAATGCTTGAAGGAGTGCAAGGACCTACTGCAGTCAGGAAGCGATTTTTTGAAT
CCATCATCAAGGAAGCAGCAAGATGTATGAGACGAGACTTTGTTAAGCACCTTAAGAAGAAACTGAAACG
TATGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214947 representing NM_001017417
Red=Cloning site Green=Tags(s)

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD
SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK
YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001017417
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001017417.2, NP_001017417.1
RefSeq Size 1008 bp
RefSeq ORF 570 bp
Locus ID 541466
UniProt ID Q5HYN5
Cytogenetics Xq26.3
MW 21.1 kDa
Write Your Own Review
You're reviewing:CT45A1 (NM_001017417) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214947L3 Lenti ORF clone of Human cancer/testis antigen family 45, member A1 (CT45A1), Myc-DDK-tagged 10 ug
$600.00
RC214947L4 Lenti ORF clone of Human cancer/testis antigen family 45, member A1 (CT45A1), mGFP tagged 10 ug
$600.00
RG214947 CT45A1 (tGFP-tagged) - Human cancer/testis antigen family 45, member A1 (CT45A1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC302045 CT45A1 (untagged)-Human cancer/testis antigen family 45, member A1 (CT45A1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.