MALT1 (NM_006785) Human Tagged ORF Clone

CAT#: RC214639

MALT1 (Myc-DDK-tagged)-Human mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 1

Change vector?

USD 588


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name MALT1 (NM_006785) Human Tagged ORF Clone
Symbol MALT1
Synonyms IMD12; MLT; MLT1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214639 representing NM_006785
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCTGTTGGGGGACCCGCTACAGGCCCTGCCGCCCTCGGCCGCCCCCACGGGGCCGCTGCTCGCCC
CTCCGGCCGGCGCGACCCTCAACCGCCTGCGGGAGCCGCTGCTGCGGAGGCTCAGCGAGCTCCTGGATCA
GGCGCCCGAGGGCCGGGGCTGGAGGAGACTGGCGGAGCTGGCGGGGAGTCGCGGGCGCCTCCGCCTCAGT
TGCCTAGACCTGGAGCAGTGTTCTCTTAAGGTACTGGAGCCTGAAGGAAGCCCCAGCCTGTGTCTGCTGA
AGTTAATGGGTGAAAAAGGTTGCACAGTCACAGAATTGAGTGATTTCCTGCAGGCTATGGAACACACTGA
AGTTCTTCAGCTTCTCAGCCCCCCAGGAATAAAGATTACTGTAAACCCAGAGTCAAAGGCAGTCTTGGCT
GGACAGTTTGTGAAACTGTGTTGCCGGGCAACTGGACATCCTTTTGTTCAATATCAGTGGTTCAAAATGA
ATAAAGAGATTCCAAATGGAAATACATCAGAGCTTATTTTTAATGCAGTGCATGTAAAAGATGCAGGCTT
TTATGTCTGTCGAGTTAATAACAATTTCACCTTTGAATTCAGCCAGTGGTCACAGCTGGATGTTTGCGAC
ATCCCAGAGAGCTTCCAGAGAAGTGTTGATGGCGTCTCTGAATCCAAGTTGCAAATCTGTGTTGAACCAA
CTTCCCAAAAGCTGATGCCAGGCAGCACATTGGTTTTACAGTGTGTTGCTGTTGGAAGCCCTATTCCTCA
CTACCAGTGGTTCAAAAATGAATTACCATTAACACATGAGACCAAAAAGCTATACATGGTGCCTTATGTG
GATTTGGAACACCAAGGAACCTACTGGTGTCATGTATATAATGATCGAGACAGTCAAGATAGCAAGAAGG
TAGAAATCATCATAGGAAGAACAGATGAGGCAGTGGAGTGCACTGAAGATGAATTAAATAATCTTGGTCA
TCCTGATAATAAAGAGCAAACAACTGACCAGCCTTTGGCGAAGGACAAGGTTGCCCTTTTGATAGGAAAT
ATGAATTACCGGGAGCACCCCAAGCTCAAAGCTCCTTTGGTGGATGTGTACGAATTGACTAACTTACTGA
GACAGCTGGACTTCAAAGTGGTTTCACTGTTGGATCTTACTGAATATGAGATGCGTAATGCTGTGGATGA
GTTTTTACTCCTTTTAGACAAGGGAGTATATGGGTTATTATATTATGCAGGACATGGTTATGAAAATTTT
GGGAACAGCTTCATGGTCCCCGTTGATGCTCCAAATCCATATAGGTCTGAAAATTGTCTGTGTGTACAAA
ATATACTGAAATTGATGCAAGAAAAAGAAACTGGACTTAATGTGTTCTTATTGGATATGTGTAGGAAAAG
AAATGACTACGATGATACCATTCCAATCTTGGATGCACTAAAAGTCACCGCCAATATTGTGTTTGGATAT
GCCACGTGTCAAGGAGCAGAAGCTTTTGAAATCCAGCATTCTGGATTGGCAAATGGAATCTTTATGAAAT
TTTTAAAAGACAGATTATTAGAAGATAAGAAAATCACTGTGTTACTGGATGAAGTTGCAGAAGATATGGG
TAAGTGTCACCTTACCAAAGGCAAACAGGCTCTAGAGATTCGAAGTAGTTTATCTGAGAAGAGAGCACTT
ACTGATCCAATACAGGGAACAGAATATTCTGCTGAATCTCTTGTGCGGAATCTACAGTGGGCCAAGGCTC
ATGAACTTCCAGAAAGTATGTGTCTTAAGTTTGACTGTGGTGTTCAGATTCAATTAGGATTTGCAGCTGA
GTTTTCCAATGTCATGATCATCTATACAAGTATAGTTTACAAACCACCGGAGATAATAATGTGTGATGCC
TACGTTACTGATTTTCCACTTGATCTAGATATTGATCCAAAAGATGCAAATAAAGGCACACCTGAAGAAA
CTGGCAGCTACTTGGTATCAAAGGATCTTCCCAAGCATTGCCTCTATACCAGACTCAGTTCACTGCAAAA
ATTAAAGGAACATCTAGTCTTCACAGTATGTTTATCATATCAGTACTCAGGATTGGAAGATACTGTAGAG
GACAAGCAGGAAGTGAATGTTGGGAAACCTCTCATTGCTAAATTAGACATGCATCGAGGTTTGGGAAGGA
AGACTTGCTTTCAAACTTGTCTTATGTCTAATGGTCCTTACCAGAGTTCTGCAGCCACCTCAGGAGGAGC
AGGGCATTATCACTCATTGCAAGACCCATTCCATGGTGTTTACCATTCACATCCTGGTAATCCAAGTAAT
GTTACACCAGCAGATAGCTGTCATTGCAGCCGGACTCCAGATGCATTTATTTCAAGTTTCGCTCACCATG
CTTCATGTCATTTTAGTAGAAGTAATGTGCCAGTAGAGACAACTGATGAAATACCATTTAGTTTCTCTGA
CAGGCTCAGAATTTCTGAAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214639 representing NM_006785
Red=Cloning site Green=Tags(s)

MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLS
CLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLA
GQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCD
IPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYV
DLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGN
MNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGY
ATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRAL
TDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDA
YVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVE
DKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSN
VTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006785
ORF Size 2472 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006785.1, NM_006785.2, NM_006785.3, NP_006776
RefSeq Size 5029
RefSeq ORF 2475
Locus ID 10892
Cytogenetics 18q21.32
Domains death, ig, IGc2, IG
Protein Families Protease, Druggable Genome
Protein Pathways T cell receptor signaling pathway, B cell receptor signaling pathway
MW 92.1 kDa
Gene Summary This gene has been found to be recurrently rearranged in chromosomal translocation with two other genes - baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) and immunoglobulin heavy chain locus - in mucosa-associated lymphoid tissue lymphomas. The protein encoded by this gene may play a role in NF-kappaB activation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations