FSH beta (FSHB) (NM_001018080) Human Tagged ORF Clone

SKU
RC214616
FSHB (Myc-DDK-tagged)-Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FSH beta
Synonyms HH24
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214616 representing NM_001018080
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACACTCCAGTTTTTCTTCCTTTTCTGTTGCTGGAAAGCAATCTGCTGCAATAGCTGTGAGCTGA
CCAACATCACCATTGCAATAGAGAAAGAAGAATGTCGTTTCTGCATAAGCATCAACACCACTTGGTGTGC
TGGCTACTGCTACACCAGGGATCTGGTGTATAAGGACCCAGCCAGGCCCAAAATCCAGAAAACATGTACC
TTCAAGGAACTGGTATACGAAACAGTGAGAGTGCCCGGCTGTGCTCACCATGCAGATTCCTTGTATACAT
ACCCAGTGGCCACCCAGTGTCACTGTGGCAAGTGTGACAGCGACAGCACTGATTGTACTGTGCGAGGCCT
GGGGCCCAGCTACTGCTCCTTTGGTGAAATGAAAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214616 representing NM_001018080
Red=Cloning site Green=Tags(s)

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT
FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001018080
ORF Size 387 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001018080.3
RefSeq Size 1906 bp
RefSeq ORF 390 bp
Locus ID 2488
UniProt ID P01225
Cytogenetics 11p14.1
Protein Families Druggable Genome, Secreted Protein
Protein Pathways GnRH signaling pathway, Neuroactive ligand-receptor interaction
MW 14.7 kDa
Summary The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:FSH beta (FSHB) (NM_001018080) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214616L3 Lenti ORF clone of Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC214616L4 Lenti ORF clone of Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, mGFP tagged 10 ug
$450.00
RG214616 FSHB (tGFP-tagged) - Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2 10 ug
$489.00
SC302166 FSHB (untagged)-Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.