BTG2 (NM_006763) Human Tagged ORF Clone

SKU
RC214600
BTG2 (Myc-DDK-tagged)-Human BTG family, member 2 (BTG2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BTG2
Synonyms APRO1; PC3; TIS21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214600 representing NM_006763
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCACGGGAAGGGAACCGACATGCTCCCGGAGATCGCCGCCGCCGTGGGCTTCCTCTCCAGCCTCC
TGAGGACCCGGGGCTGCGTGAGCGAGCAGAGGCTTAAGGTCTTCAGCGGGGCGCTCCAGGAGGCACTCAC
AGAGCACTACAAACACCACTGGTTTCCCGAAAAGCCGTCCAAGGGCTCCGGCTACCGCTGCATTCGCATC
AACCACAAGATGGACCCCATCATCAGCAGGGTGGCCAGCCAGATCGGACTCAGCCAGCCCCAGCTGCACC
AGCTGCTGCCCAGCGAGCTGACCCTGTGGGTGGACCCCTATGAGGTGTCCTACCGCATTGGGGAGGACGG
CTCCATCTGCGTCTTGTACGAGGAGGCCCCACTGGCCGCCTCCTGTGGGCTCCTCACCTGCAAGAACCAA
GTGCTGCTGGGCCGGAGCAGCCCCTCCAAGAACTACGTGATGGCAGTCTCCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214600 representing NM_006763
Red=Cloning site Green=Tags(s)

MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRI
NHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQ
VLLGRSSPSKNYVMAVSS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006763
ORF Size 474 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006763.3
RefSeq Size 2718 bp
RefSeq ORF 477 bp
Locus ID 7832
UniProt ID P78543
Cytogenetics 1q32.1
Domains Anti_proliferat
Protein Families Transcription Factors
MW 17.2 kDa
Summary The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:BTG2 (NM_006763) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214600L1 Lenti ORF clone of Human BTG family, member 2 (BTG2), Myc-DDK-tagged 10 ug
$450.00
RC214600L2 Lenti ORF clone of Human BTG family, member 2 (BTG2), mGFP tagged 10 ug
$450.00
RC214600L3 Lenti ORF clone of Human BTG family, member 2 (BTG2), Myc-DDK-tagged 10 ug
$450.00
RC214600L4 Lenti ORF clone of Human BTG family, member 2 (BTG2), mGFP tagged 10 ug
$450.00
RG214600 BTG2 (tGFP-tagged) - Human BTG family, member 2 (BTG2) 10 ug
$489.00
SC115914 BTG2 (untagged)-Human BTG family, member 2 (BTG2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.