HOXB1 (NM_002144) Human Tagged ORF Clone

SKU
RC214217
HOXB1 (Myc-DDK-tagged)-Human homeobox B1 (HOXB1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HOXB1
Synonyms HCFP3; Hox-2.9; HOX2; HOX2I
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214217 representing NM_002144
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTATAATAGGATGAACTCCTTCTTAGAGTACCCACTCTGTAACCGGGGACCCAGCGCCTACAGCG
CCCACAGCGCCCCAACCTCCTTTCCCCCAAGCTCGGCTCAGGCGGTTGACAGCTATGCAAGCGAGGGCCG
CTACGGTGGGGGGCTGTCCAGCCCTGCGTTTCAGCAGAACTCCGGCTATCCCGCCCAGCAGCCGCCTTCG
ACCCTGGGGGTGCCCTTCCCCAGCTCCGCGCCCTCGGGGTATGCTCCTGCCGCCTGCAGCCCCAGCTACG
GGCCTTCTCAGTACTACCCTCTGGGTCAATCAGAAGGAGACGGAGGCTATTTTCATCCCTCGAGCTACGG
GGCCCAGCTAGGGGGCTTGTCCGATGGCTACGGAGCAGGTGGAGCCGGTCCGGGGCCATATCCTCCGCAG
CATCCCCCTTATGGGAACGAGCAGACCGCGAGCTTTGCACCGGCCTATGCTGATCTCCTCTCCGAGGACA
AGGAAACACCCTGCCCTTCAGAACCTAACACCCCCACGGCCCGGACCTTCGACTGGATGAAGGTTAAGAG
AAACCCACCCAAGACAGCGAAGGTGTCAGAGCCAGGCCTGGGCTCGCCCAGTGGCCTCCGCACCAACTTC
ACCACAAGGCAGCTGACAGAACTGGAAAAGGAGTTCCATTTCAACAAGTACCTGAGCCGGGCCCGGAGGG
TGGAGATTGCCGCCACCCTGGAGCTCAATGAAACACAGGTCAAGATTTGGTTCCAGAACCGACGAATGAA
GCAGAAGAAGCGCGAGCGAGAGGAAGGTCGGGTCCCCCCAGCCCCACCAGGCTGCCCCAAGGAGGCAGCT
GGAGATGCCTCAGACCAGTCGACATGCACCTCCCCGGAAGCCTCACCCAGCTCTGTCACCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214217 representing NM_002144
Red=Cloning site Green=Tags(s)

MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPS
TLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQ
HPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF
TTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAA
GDASDQSTCTSPEASPSSVTS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002144
ORF Size 903 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002144.4
RefSeq Size 1014 bp
RefSeq ORF 906 bp
Locus ID 3211
UniProt ID P14653
Cytogenetics 17q21.32
Protein Families Transcription Factors
MW 32 kDa
Summary This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HOXB1 (NM_002144) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214217L1 Lenti ORF clone of Human homeobox B1 (HOXB1), Myc-DDK-tagged 10 ug
$750.00
RC214217L2 Lenti ORF clone of Human homeobox B1 (HOXB1), mGFP tagged 10 ug
$750.00
RC214217L3 Lenti ORF clone of Human homeobox B1 (HOXB1), Myc-DDK-tagged 10 ug
$750.00
RC214217L4 Lenti ORF clone of Human homeobox B1 (HOXB1), mGFP tagged 10 ug
$750.00
RG214217 HOXB1 (tGFP-tagged) - Human homeobox B1 (HOXB1) 10 ug
$650.00
SC303126 HOXB1 (untagged)-Human homeobox B1 (HOXB1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.