OR51M1 (NM_001004756) Human Tagged ORF Clone

SKU
RC213981
OR51M1 (Myc-DDK-tagged)-Human olfactory receptor, family 51, subfamily M, member 1 (OR51M1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OR51M1
Synonyms HOR5'Beta7; OR11-40
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213981 representing NM_001004756
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGTCCAATATTCGCTCAGTCCTCAATTCATGCTGCTATCCAACATTACTCAGTTTAGCCCCATAT
TCTATCTCACCAGCTTTCCTGGATTGGAAGGCATCAAACACTGGATTTTCATCCCCTTTTTCTTTATGTA
CATGGTTGCCATCTCAGGCAATTGTTTCATTCTGATCATTATTAAGACCAACCCTCGTCTGCACACACCC
ATGTACTATCTACTATCCTTGCTGGCCCTCACTGACCTGGGGCTGTGTGTGTCCACGTTGCCCACCACTA
TGGGGATCTTCTGGTTTAACTCCCAGAGTATCTACTTTGGAGCGTGTCAAATCCAGATGTTCTGCATCCA
CTCTTTTTCCTTCATGGAGTCCTCAGTGCTCCTCATGATGTCCTTTGACCGCTTTGTGGCCATCTGCCAC
CCTCTGAGGTATTCGGTCATTATCACTGGCCAGCAAGTGGTCAGAGCAGGCCTAATTGTCATCTTCCGGG
GACCTGTGGCCACTATCCCTATTGTCCTCCTCCTGAAGGCTTTTCCCTACTGTGGATCTGTGGTCCTCTC
CCACTCATTTTGCCTGCACCAGGAAGTGATACAGCTGGCCTGCACAGATACCACCTTCAATAATCTGTAT
GGACTGATGGTGGTAGTTTTCACTGTGATGCTGGACCTGGTGCTCATCGCACTGTCCTATGGACTCATCC
TGCACACAGTAGCAGGCCTGGCCTCCCAAGAGGAGCAGCGCCGTGCCTTTCAGACATGCACCGCTCATCT
CTGTGCTGTGCTAGTATTCTTTGTGCCCATGATGGGGCTGTCCCTGGTGCACCGTTTTGGGAAGCATGCC
CCACCTGCTATTCATCTTCTTATGGCCAATGTCTACCTTTTTGTGCCTCCCATGCTTAACCCAATCATAT
ACAGCATTAAGACCAAGGAGATCCACCGTGCCATTATCAAACTCCTAGGTCTTAAAAAGGCCAGTAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213981 representing NM_001004756
Red=Cloning site Green=Tags(s)

MSVQYSLSPQFMLLSNITQFSPIFYLTSFPGLEGIKHWIFIPFFFMYMVAISGNCFILIIIKTNPRLHTP
MYYLLSLLALTDLGLCVSTLPTTMGIFWFNSQSIYFGACQIQMFCIHSFSFMESSVLLMMSFDRFVAICH
PLRYSVIITGQQVVRAGLIVIFRGPVATIPIVLLLKAFPYCGSVVLSHSFCLHQEVIQLACTDTTFNNLY
GLMVVVFTVMLDLVLIALSYGLILHTVAGLASQEEQRRAFQTCTAHLCAVLVFFVPMMGLSLVHRFGKHA
PPAIHLLMANVYLFVPPMLNPIIYSIKTKEIHRAIIKLLGLKKASK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001004756
ORF Size 978 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001004756.1, NP_001004756.1
RefSeq Size 981 bp
RefSeq ORF 981 bp
Locus ID 390059
UniProt ID Q9H341
Cytogenetics 11p15.4
Protein Families Transmembrane
Protein Pathways Olfactory transduction
MW 36.5 kDa
Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:OR51M1 (NM_001004756) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213981L3 Lenti ORF clone of Human olfactory receptor, family 51, subfamily M, member 1 (OR51M1), Myc-DDK-tagged 10 ug
$600.00
RC213981L4 Lenti ORF clone of Human olfactory receptor, family 51, subfamily M, member 1 (OR51M1), mGFP tagged 10 ug
$600.00
RG213981 OR51M1 (tGFP-tagged) - Human olfactory receptor, family 51, subfamily M, member 1 (OR51M1) 10 ug
$500.00
SC300794 OR51M1 (untagged)-Human olfactory receptor, family 51, subfamily M, member 1 (OR51M1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.