CABP5 (NM_019855) Human Tagged ORF Clone

SKU
RC213946
CABP5 (Myc-DDK-tagged)-Human calcium binding protein 5 (CABP5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CABP5
Synonyms CABP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213946 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTTCCCCATGGGCCCCGCCTGCATCTTCTTGAGGAAAGGCATTGCTGAGAAACAGCGGGAAAGAC
CACTGGGACAAGATGAGATTGAAGAGCTGCGGGAAGCATTTCTTGAGTTCGATAAGGACCGAGATGGGTT
CATCTCTTGTAAGGATCTGGGGAATCTCATGAGGACGATGGGTTACATGCCCACGGAGATGGAACTGATT
GAGCTCGGCCAGCAAATCCGCATGAACTTGGGTGGCCGTGTAGACTTTGATGACTTTGTGGAGCTGATGA
CCCCCAAATTGCTTGCAGAAACAGCTGGGATGATCGGTGTCCAGGAGATGCGGGATGCCTTCAAGGAGTT
TGACACGAATGGAGATGGGGAGATCACCCTGGTGGAGCTACAGCAGGCCATGCAGAGACTCCTGGGGGAG
CGGCTCACCCCCCGGGAGATCTCTGAGGTTGTCCGGGAGGCTGATGTTAATGGAGACGGCACAGTTGACT
TTGAAGAGTTTGTGAAGATGATGTCTCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213946 protein sequence
Red=Cloning site Green=Tags(s)

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELI
ELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGE
RLTPREISEVVREADVNGDGTVDFEEFVKMMSR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_019855
ORF Size 519 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019855.3, NP_062829.1
RefSeq Size 1845 bp
RefSeq ORF 522 bp
Locus ID 56344
UniProt ID Q9NP86
Cytogenetics 19q13.33
MW 19.8 kDa
Summary The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:CABP5 (NM_019855) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213946L3 Lenti ORF clone of Human calcium binding protein 5 (CABP5), Myc-DDK-tagged 10 ug
$600.00
RC213946L4 Lenti ORF clone of Human calcium binding protein 5 (CABP5), mGFP tagged 10 ug
$600.00
RG213946 CABP5 (tGFP-tagged) - Human calcium binding protein 5 (CABP5) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC304688 CABP5 (untagged)-Human calcium binding protein 5 (CABP5) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.