TRPM3 (NM_001007470) Human Tagged ORF Clone

SKU
RC213931
TRPM3 (Myc-DDK-tagged)-Human transient receptor potential cation channel, subfamily M, member 3 (TRPM3), transcript variant 8
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRPM3
Synonyms GON-2; LTRPC3; MLSN2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213931 representing NM_001007470
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATGTGCGAGTATCTTTTGATACAAAACCTGATCTCCTCTTACACCTGATGACCAAGGAATGGCAGT
TGGAGCTTCCCAAGCTTCTCATCTCTGTCCATGGGGGCCTGCAGAACTTTGAACTCCAGCCAAAACTCAA
GCAAGTCTTTGGGAAAGGGCTCATCAAAGCAGCAATGACAACTGGAGCGTGGATATTCACTGGAGGGGTT
AACACAGGTGTTATTCGTCATGTTGGCGATGCCTTGAAGGATCATGCCTCTAAGTCTCGAGGAAAGATAT
GCACCATAGGTATTGCCCCCTGGGGAATTGTGGAAAACCAGGAGGACCTCATTGGAAGAGATGTTGTCCG
GCCATACCAGACCATGTCCAATCCCATGAGCAAGCTCACTGTTCTCAACAGCATGCATTCCCACTTCATT
CTGGCTGACAACGGGACCACTGGAAAATATGGAGCAGAGGTGAAACTTCGAAGACAACTGGAAAAGCATA
TTTCACTCCAGAAGATAAACACAAGATGCCTGCCGTTTTTCTCTCTTGACTCCCGCTTGTTTTATTCATT
TTGGGGTAGTTGCCAGTTAGACTCAGTTGGAATCGGTCAAGGTGTTCCTGTGGTGGCACTCATAGTGGAA
GGAGGACCCAATGTGATCTCGATTGTTTTGGAGTACCTTCGAGACACCCCTCCCGTGCCAGTGGTTGTCT
GTGATGGGAGTGGACGGGCATCGGACATCCTGGCCTTTGGGCATAAATACTCAGAAGAAGGCGGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213931 representing NM_001007470
Red=Cloning site Green=Tags(s)

MYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGV
NTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFI
LADNGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVALIVE
GGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001007470
ORF Size 765 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001007470.2
RefSeq Size 1378 bp
RefSeq ORF 768 bp
Locus ID 80036
Cytogenetics 9q21.12-q21.13
Protein Families Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane
MW 27.8 kDa
Summary The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TRPM3 (NM_001007470) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213931L3 Lenti-ORF clone of TRPM3 (Myc-DDK-tagged)-Human transient receptor potential cation channel, subfamily M, member 3 (TRPM3), transcript variant 8 10 ug
$630.00
RC213931L4 Lenti-ORF clone of TRPM3 (mGFP-tagged)-Human transient receptor potential cation channel, subfamily M, member 3 (TRPM3), transcript variant 8 10 ug
$630.00
RG213931 TRPM3 (tGFP-tagged) - Human transient receptor potential cation channel, subfamily M, member 3 (TRPM3), transcript variant 8 10 ug
$530.00
SC301217 TRPM3 (untagged)-Human transient receptor potential cation channel, subfamily M, member 3 (TRPM3), transcript variant 8 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.