OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CTLA4 (NM_001037631) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC213631
CTLA4 (Myc-DDK-tagged)-Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $450.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA810204 CTLA4 mouse monoclonal antibody,clone OTI8F1 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CTLA4 or NM_001037631"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CTLA4
Synonyms ALPS5; CD; CD152; CELIAC3; CTLA-4; GRD4; GSE; IDDM12
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213631 representing NM_001037631
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTGCCTTGGATTTCAGCGGCACAAGGCTCAGCTGAACCTGGCTACCAGGACCTGGCCCTGCACTC
TCCTGTTTTTTCTTCTCTTCATCCCTGTCTTCTGCAAAGCAATGCACGTGGCCCAGCCTGCTGTGGTACT
GGCCAGCAGCCGAGGCATCGCCAGCTTTGTGTGTGAGTATGCATCTCCAGGCAAAGCCACTGAGGTCCGG
GTGACAGTGCTTCGGCAGGCTGACAGCCAGGTGACTGAAGTCTGTGCGGCAACCTACATGATGGGGAATG
AGTTGACCTTCCTAGATGATTCCATCTGCACGGGCACCTCCAGTGGAAATCAAGTGAACCTCACTATCCA
AGGACTGAGGGCCATGGACACGGGACTCTACATCTGCAAGGTGGAGCTCATGTACCCACCGCCATACTAC
CTGGGCATAGGCAACGGAACCCAGATTTATGTAATTGCTAAAGAAAAGAAGCCCTCTTACAACAGGGGTC
TATGTGAAAATGCCCCCAACAGAGCCAGAATG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC213631 representing NM_001037631
Red=Cloning site Green=Tags(s)

MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVR
VTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYY
LGIGNGTQIYVIAKEKKPSYNRGLCENAPNRARM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001037631
ORF Size 522 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001037631.3
RefSeq Size 1878 bp
RefSeq ORF 525 bp
Locus ID 1493
UniProt ID P16410
Cytogenetics 2q33.2
Protein Families Druggable Genome, Transmembrane
Protein Pathways Autoimmune thyroid disease, Cell adhesion molecules (CAMs), T cell receptor signaling pathway
MW 19.15 kDa
Summary This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001037631" in other vectors (6)
SKU Description Size Price
RC213631L1 Lenti ORF clone of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC213631L2 Lenti ORF clone of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2, mGFP tagged 10 ug
$750.00
RC213631L3 Lenti ORF clone of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC213631L4 Lenti ORF clone of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2, mGFP tagged 10 ug
$750.00
RG213631 CTLA4 (tGFP-tagged) - Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2 10 ug
$489.00 $650.00
SC302916 CTLA4 (untagged)-Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2 10 ug
$300.00

Plasmid Map for RC213631

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC213631
Circular map for RC213631

file-alt Citations

Case Report: Aplastic anemia related to a novel CTLA4 variant
Hall, Markle, Maiarana et al
Front Pediatr (2024) 12, 1434076 DOI: 10.3389/fped.2024.1434076
AI Summary: OriGene’s pCMV6-CTLA4-MycDDK plasmid (#RC213631) was used to generate wild-type and mutant CTLA4 constructs, enabling functional assays that demonstrated impaired CTLA-4 expression associated with the novel CTLA4 variant in this case of aplastic anemia.
Snippet: logies for the aplastic anemia, a research-based functional assay was pursued. A CTLA-4 functional assay was performed as previously described (19–21). pCMV6-CTLA4-MycDDK plasmid was obtained from Origene (#RC213631). Construct carrying C129S mutant allele was generated from the wild type (WT) plasmid by site-directed mutagenesis (QuikChange II XL;Agilent Technologies, #200523) according to ma
FigureFigure
Interferon-γ Signaling in Melanocytes and Melanoma Cells Regulates Expression of CTLA-4
Mo, Zhang, Preston et al
Cancer Res. (2018) 78 (2), 436-450 DOI: 10.1158/0008-5472.CAN-17-1615
AI Summary: OriGene’s Human CTLA4 ORF cDNA vector was used in this study to investigate the regulation and expression of CTLA4 in melanocytes and melanoma cells.
Snippet: The 1021-base pair (bp) segment of CTLA4 promoter luciferase construct containing four putative GAS sites was synthesized and cloned into a firefly luciferase vector (pGL4.20 [luc2/Puro], Promega) by Genescript gene synthesis and cloning service. Site-directed mutagenesis was performed by QuikChange II site-directed Mutagenesis Kit (Agilent Technologies) and generated mutants with deletion of each putative GAS sites by manufacture’s protocol. Human CTLA4 ORF cDNA vector was purchased from Origene
FigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products