Asialoglycoprotein Receptor 2 (ASGR2) (NM_001181) Human Tagged ORF Clone

SKU
RC213607
ASGR2 (Myc-DDK-tagged)-Human asialoglycoprotein receptor 2 (ASGR2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Target Symbol Asialoglycoprotein Receptor 2
Synonyms ASGP-R2; ASGPR2; CLEC4H2; HBXBP; HL-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213607 representing NM_001181
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGGACTTTCAAGATATCCAGCAGCTGAGCTCGGAGGAAAATGACCATCCTTTCCATCAAGGTG
AGGGGCCAGGCACTCGCAGGCTGAATCCCAGGAGAGGAAATCCATTTTTGAAAGGGCCACCTCCTGCCCA
GCCCCTGGCACAGCGTCTCTGCTCCATGGTCTGCTTCAGTCTGCTTGCCCTGAGCTTCAACATCCTGCTG
CTGGTGGTCATCTGTGTGACTGGGTCCCAAAGTGAGGGTCACAGAGGTGCACAGCTGCAAGCCGAGCTGC
GGAGCCTGAAGGAAGCTTTCAGCAACTTCTCCTCGAGCACCCTGACGGAGGTCCAGGCAATCAGCACCCA
CGGAGGCAGCGTGGGTGACAAGATCACATCCCTAGGAGCCAAGCTGGAGAAACAGCAGCAGGACCTGAAA
GCAGATCACGATGCCCTGCTCTTCCATCTGAAGCACTTCCCCGTGGACCTGCGCTTCGTGGCCTGCCAGA
TGGAGCTCCTCCACAGCAACGGCTCCCAAAGGACCTGCTGCCCCGTCAACTGGGTGGAGCACCAAGGCAG
CTGCTACTGGTTCTCTCACTCCGGGAAGGCCTGGGCTGAGGCGGAGAAGTACTGCCAGCTGGAGAACGCA
CACCTTGTGGTCATCAACTCCTGGGAGGAGCAGAAATTCATTGTACAACACACGAACCCCTTCAATACCT
GGATAGGTCTCACGGACAGTGATGGCTCTTGGAAATGGGTGGATGGCACAGACTATAGGCACAACTACAA
GAACTGGGCTGTCACTCAGCCAGATAATTGGCACGGGCACGAGCTGGGTGGAAGTGAAGACTGTGTTGAA
GTCCAGCCGGATGGCCGCTGGAACGATGACTTCTGCCTGCAGGTGTACCGCTGGGTGTGTGAGAAAAGGC
GGAATGCCACCGGCGAGGTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213607 representing NM_001181
Red=Cloning site Green=Tags(s)

MAKDFQDIQQLSSEENDHPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPLAQRLCSMVCFSLLALSFNILL
LVVICVTGSQSEGHRGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLK
ADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENA
HLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVE
VQPDGRWNDDFCLQVYRWVCEKRRNATGEVA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001181
ORF Size 933 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001181.4
RefSeq Size 1405 bp
RefSeq ORF 936 bp
Locus ID 433
UniProt ID P07307
Cytogenetics 17p13.1
Domains CLECT, lectin_N
Protein Families Druggable Genome, Transmembrane
MW 35 kDa
Summary This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
Write Your Own Review
You're reviewing:Asialoglycoprotein Receptor 2 (ASGR2) (NM_001181) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213607L1 Lenti ORF clone of Human asialoglycoprotein receptor 2 (ASGR2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC213607L2 Lenti ORF clone of Human asialoglycoprotein receptor 2 (ASGR2), transcript variant 1, mGFP tagged 10 ug
$600.00
RC213607L3 Lenti ORF clone of Human asialoglycoprotein receptor 2 (ASGR2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC213607L4 Lenti ORF clone of Human asialoglycoprotein receptor 2 (ASGR2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG213607 ASGR2 (tGFP-tagged) - Human asialoglycoprotein receptor 2 (ASGR2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119380 ASGR2 (untagged)-Human asialoglycoprotein receptor 2 (ASGR2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.