MRP6 (ABCC6) (NM_001079528) Human Tagged ORF Clone

SKU
RC213357
ABCC6 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MRP6
Synonyms ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213357 representing NM_001079528
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCGCCTGCTGAGCCCTGCGCGGGGCAGGGGGTCTGGAACCAGACAGAGCCTGAACCTGCCGCCA
CCAGCCTGCTGAGCCTGTGCTTCCTGAGAACAGCAGGGGTCTGGGTACCCCCCATGTACCTCTGGGTCCT
TGGTCCCATCTACCTCCTCTTCATCCACCACCATGGCCGGGGCTACCTCCGGATGTCCCCACTCTTCAAA
GCCAAGATGGTAGCTGCCATCCCTGGGAGCCTGGAACCAGGCAATGTTCGGGGGAGGCAGGGGACAGGCT
GGAACCTGGTGAAGTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213357 representing NM_001079528
Red=Cloning site Green=Tags(s)

MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFK
AKMVAAIPGSLEPGNVRGRQGTGWNLVKS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001079528
ORF Size 297 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001079528.4
RefSeq Size 727 bp
RefSeq ORF 300 bp
Locus ID 368
UniProt ID O95255
Cytogenetics 16p13.11
Protein Families Druggable Genome, Transmembrane
Protein Pathways ABC transporters
MW 10.6 kDa
Summary The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MRP6 (ABCC6) (NM_001079528) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213357L1 Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC213357L2 Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, mGFP tagged 10 ug
$450.00
RC213357L3 Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC213357L4 Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, mGFP tagged 10 ug
$450.00
RG213357 ABCC6 (tGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2 10 ug
$350.00
SC315468 ABCC6 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.