ECSCR (NM_001077693) Human Tagged ORF Clone

SKU
RC213303
ECSCR (Myc-DDK-tagged)-Human endothelial cell-specific chemotaxis regulator (ECSCR)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ECSCR
Synonyms ARIA; ECSM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213303 representing NM_001077693
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCACCGCAGGAGCCATGCAGCTGTGCTGGGTGATCCTGGGCTTCCTCCTGTTCCGAGGCCACAACT
CCCAGCCCACAATGACCCAGACCTCTAGCTCTCAGGGAGGCCTTGGCGGTCTAAGTCTGACCACAGAGCC
AGTTTCTTCCAACCCAGGATACATCCCTTCCTCAGAGGCTAACAGGCCAAGCCATCTGTCCAGCACTGGT
ACCCCAGGCGCAGGTGTCCCCAGCAGTGGAAGAGACGGAGGCACAAGCAGAGACACATTTCAAACTGTTC
CCCCCAATTCAACCACCATGAGCCTGAGCATGAGGGAAGATGCGACCATCCTGCCCAGCCCCACGTCAGA
GACTGTGCTCACTGTGGCTGCATTTGGTGTTATCAGCTTCATTGTCATCCTGGTGGTTGTGGTGATCATC
CTAGTTGGTGTGGTCAGCCTGAGGTTCAAGTGTCGGAAGAGCAAGGAGTCTGAAGATCCCCAGAAACCTG
GGAGTTCAGGGCTGTCTGAAAGCTGCTCCACAGCCAATGGAGAGAAAGACAGCATCACCCTTATCTCCAT
GAAGAACATCAACATGAATAATGGCAAACAAAGTCTCTCAGCAGAGAAGGTTCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213303 representing NM_001077693
Red=Cloning site Green=Tags(s)

MGTAGAMQLCWVILGFLLFRGHNSQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTG
TPGAGVPSSGRDGGTSRDTFQTVPPNSTTMSLSMREDATILPSPTSETVLTVAAFGVISFIVILVVVVII
LVGVVSLRFKCRKSKESEDPQKPGSSGLSESCSTANGEKDSITLISMKNINMNNGKQSLSAEKVL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001077693
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001077693.4
RefSeq Size 1030 bp
RefSeq ORF 618 bp
Locus ID 641700
UniProt ID Q19T08
Cytogenetics 5q31.2
MW 21.1 kDa
Summary The protein encoded by this gene is primarily found in endothelial cells and blood vessels, where it is involved in cell shape changes and EGF-induced cell migration. It can enhance the activation of vascular endothelial growth factor receptor-2/kinase insert domain receptor and also promote the proteolysis of internalized kinase insert domain receptor. This gene may play a role in angiogenesis-related diseases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]
Write Your Own Review
You're reviewing:ECSCR (NM_001077693) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213303L1 Lenti ORF clone of Human endothelial cell-specific chemotaxis regulator (ECSCR), Myc-DDK-tagged 10 ug
$600.00
RC213303L2 Lenti ORF clone of Human endothelial cell-specific chemotaxis regulator (ECSCR), mGFP tagged 10 ug
$600.00
RC213303L3 Lenti ORF clone of Human endothelial cell-specific chemotaxis regulator (ECSCR), Myc-DDK-tagged 10 ug
$600.00
RC213303L4 Lenti ORF clone of Human endothelial cell-specific chemotaxis regulator (ECSCR), mGFP tagged 10 ug
$600.00
RG213303 ECSCR (tGFP-tagged) - Human endothelial cell-specific chemotaxis regulator (ECSCR) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC315488 ECSCR (untagged)-Human endothelial cell-specific chemotaxis regulator (ECSCR) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.