C9orf21 (AAED1) (NM_153698) Human Tagged ORF Clone

SKU
RC213257
AAED1 (Myc-DDK-tagged)-Human chromosome 9 open reading frame 21 (C9orf21)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C9orf21
Synonyms AAED1; C9orf21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213257 representing NM_153698
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCGCCGGCCCCGGTCACGCGGCAGGTTAGCGGCGCCGCCGCCCTGGTCCCGGCCCCGAGCGGCC
CCGACAGCGGGCAGCCCCTGGCGGCCGCCGTGGCCGAGCTGCCGGTGCTGGACGCCCGCGGGCAGCGGGT
ACCGTTCGGCGCGCTGTTCCGGGAGCGCCGCGCCGTGGTGGTGTTCGTGCGGCATTTCCTGTGTTACATC
TGCAAGGAATACGTAGAGGATCTGGCCAAAATCCCCAGGAGTTTCTTACAAGAAGCAAATGTCACCCTTA
TAGTGATTGGACAGTCATCCTACCATCATATTGAGCCTTTTTGCAAGCTGACTGGATATTCTCATGAAAT
CTATGTCGATCCTGAGAGAGAAATTTATAAAAGATTGGGAATGAAAAGAGGTGAAGAAATTGCTTCCTCA
GGACAGAGCCCCCACATAAAATCAAATCTACTCTCAGGAAGCCTTCAGAGCCTGTGGCGGGCAGTGACTG
GCCCTCTCTTTGATTTTCAAGGAGACCCAGCTCAGCAAGGTGGAACCCTCATTTTAGGTCCAGGTAACAA
CATCCATTTTATACACCGCGATAGGAATAGGTTGGATCACAAACCTATCAACTCTGTTTTACAGCTTGTA
GGAGTTCAGCATGTGAACTTTACAAACAGACCTTCAGTTATCCATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213257 representing NM_153698
Red=Cloning site Green=Tags(s)

MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYI
CKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASS
GQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLV
GVQHVNFTNRPSVIHV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_153698
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_153698.2
RefSeq Size 1242 bp
RefSeq ORF 681 bp
Locus ID 195827
UniProt ID Q7RTV5
Cytogenetics 9q22.33
MW 24.7 kDa
Summary May regulate positively ERK1/2 signaling and AKT1 activation leading to HIF1A up-regulation with an increased expression of glycolysis genes and enhanced glycolysis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C9orf21 (AAED1) (NM_153698) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213257L3 Lenti ORF clone of Human chromosome 9 open reading frame 21 (C9orf21), Myc-DDK-tagged 10 ug
$600.00
RC213257L4 Lenti ORF clone of Human chromosome 9 open reading frame 21 (C9orf21), mGFP tagged 10 ug
$600.00
RG213257 AAED1 (tGFP-tagged) - Human chromosome 9 open reading frame 21 (C9orf21) 10 ug
$500.00
SC306642 AAED1 (untagged)-Human chromosome 9 open reading frame 21 (C9orf21) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.