Bcl2 Binding component 3 (BBC3) (NM_014417) Human Tagged ORF Clone

SKU
RC213203
BBC3 (Myc-DDK-tagged)-Human BCL2 binding component 3 (BBC3), transcript variant 4
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Target Symbol Bcl2 Binding component 3
Synonyms JFY-1; JFY1; PUMA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213203 representing NM_014417
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGCGCACGCCAGGAGGGCAGCTCCCCGGAGCCCGTAGAGGGCCTGGCCCGCGACGGCCCGCGCC
CCTTCCCGCTCGGCCGCCTGGTGCCCTCGGCAGTGTCCTGCGGCCTCTGCGAGCCCGGCCTGGCTGCCGC
CCCCGCCGCCCCCACCCTGCTGCCCGCTGCCTACCTCTGCGCCCCCACCGCCCCACCCGCCGTCACCGCC
GCCCTGGGGGGTTCCCGCTGGCCTGGGGGTCCCCGCAGCCGGCCCCGAGGCCCGCGCCCGGACGGTCCTC
AGCCCTCGCTCTCGCTGGCGGAGCAGCACCTGGAGTCGCCCGTGCCCAGCGCCCCGGGGGCTCTGGCGGG
CGGTCCCACCCAGGCGGCCCCGGGAGTCCGCGGGGAGGAGGAACAGTGGGCCCGGGAGATCGGGGCCCAG
CTGCGGCGGATGGCGGACGACCTCAACGCACAGTACGAGCGGCGGAGACAAGAGGAGCAGCAGCGGCACC
GCCCCTCACCCTGGAGGGTCCTGTACAATCTCATCATGGGACTCCTGCCCTTACCCAGGGGCCACAGAGC
CCCCGAGATGGAGCCCAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213203 representing NM_014417
Red=Cloning site Green=Tags(s)

MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTA
ALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQ
LRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014417
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014417.5
RefSeq Size 1840 bp
RefSeq ORF 582 bp
Locus ID 27113
UniProt ID Q9BXH1
Cytogenetics 19q13.32
Protein Families Druggable Genome
Protein Pathways Huntington's disease, p53 signaling pathway
MW 20.4 kDa
Summary This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]
Write Your Own Review
You're reviewing:Bcl2 Binding component 3 (BBC3) (NM_014417) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213203L1 Lenti ORF clone of Human BCL2 binding component 3 (BBC3), transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC213203L2 Lenti ORF clone of Human BCL2 binding component 3 (BBC3), transcript variant 4, mGFP tagged 10 ug
$600.00
RC213203L3 Lenti ORF clone of Human BCL2 binding component 3 (BBC3), transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC213203L4 Lenti ORF clone of Human BCL2 binding component 3 (BBC3), transcript variant 4, mGFP tagged 10 ug
$600.00
RG213203 BBC3 (tGFP-tagged) - Human BCL2 binding component 3 (BBC3), transcript variant 4 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC304096 BBC3 (untagged)-Human BCL2 binding component 3 (BBC3), transcript variant 4 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.