DHLAG (CD74) (NM_001025159) Human Tagged ORF Clone

SKU
RC212964
CD74 (Myc-DDK-tagged)-Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DHLAG
Synonyms DHLAG; HLADG; Ia-GAMMA; II; p33
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212964 representing NM_001025159
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACAGGAGGAGAAGCAGGAGCTGTCGGGAAGATCAGAAGCCAGTCATGGATGACCAGCGCGACCTTA
TCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGG
AGCCCTGTACACAGGCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTACTTC
CTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCCAGAACCTGCAGCTGGAGAACCTGC
GCATGAAGCTTCCCAAGCCTCCCAAGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGC
GCTGCCCATGGGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAGAGGAC
CATGTGATGCACCTGCTCCAGAATGCTGACCCCCTGAAGGTGTACCCGCCACTGAAGGGGAGCTTCCCGG
AGAACCTGAGACACCTTAAGAACACCATGGAGACCATAGACTGGAAGGTCTTTGAGAGCTGGATGCACCA
TTGGCTCCTGTTTGAAATGAGCAGGCACTCCTTGGAGCAAAAGCCCACTGACGCTCCACCGAAAGTACTG
ACCAAGTGCCAGGAAGAGGTCAGCCACATCCCTGCTGTCCACCCGGGTTCATTCAGGCCCAAGTGCGACG
AGAACGGCAACTATCTGCCACTCCAGTGCTATGGGAGCATCGGCTACTGCTGGTGTGTCTTCCCCAACGG
CACGGAGGTCCCCAACACCAGAAGCCGCGGGCACCATAACTGCAGTGAGTCACTGGAACTGGAGGACCCG
TCTTCTGGGCTGGGTGTGACCAAGCAGGATCTGGGCCCAGTCCCCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212964 representing NM_001025159
Red=Cloning site Green=Tags(s)

MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF
LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED
HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL
TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP
SSGLGVTKQDLGPVPM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001025159
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001025159.2
RefSeq Size 1519 bp
RefSeq ORF 891 bp
Locus ID 972
UniProt ID P04233
Cytogenetics 5q33.1
Protein Families Druggable Genome, Transmembrane
Protein Pathways Antigen processing and presentation
MW 33.3 kDa
Summary The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:DHLAG (CD74) (NM_001025159) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212964L1 Lenti ORF clone of Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC212964L2 Lenti ORF clone of Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1, mGFP tagged 10 ug
$750.00
RC212964L3 Lenti ORF clone of Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC212964L4 Lenti ORF clone of Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1, mGFP tagged 10 ug
$750.00
RG212964 CD74 (tGFP-tagged) - Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC302355 CD74 (untagged)-Human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.