FOLR3 (NM_000804) Human Tagged ORF Clone

SKU
RC212963
FOLR3 (Myc-DDK-tagged)-Human folate receptor 3 (gamma) (FOLR3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FOLR3
Synonyms FR-G; FR-gamma; FRgamma; gamma-hFR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212963 representing NM_000804
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACATGGCCTGGCAGATGATGCAGCTGCTGCTTCTGGCTTTGGTGACTGCTGCGGGGAGTGCCCAGC
CCAGGAGTGCGCGGGCCAGGACGGACCTGCTCAATGTCTGCATGAACGCCAAGCACCACAAGACACAGCC
CAGCCCCGAGGACGAGCTGTATGGCCAGTGCAGTCCCTGGAAGAAGAATGCCTGCTGCACGGCCAGCACC
AGCCAGGAGCTGCACAAGGACACCTCCCGCCTGTACAACTTTAACTGGGATCACTGTGGTAAGATGGAAC
CCACCTGCAAGCGCCACTTTATCCAGGACAGCTGTCTCTATGAGTGCTCACCCAACCTGGGGCCCTGGAT
CCGGCAGGTCAACCAGAGCTGGCGCAAAGAGCGCATTCTGAACGTGCCCCTGTGCAAAGAGGACTGTGAG
CGCTGGTGGGAGGACTGTCGCACCTCCTACACCTGCAAAAGCAACTGGCACAAAGGCTGGAATTGGACCT
CAGGGATTAATGAGTGTCCGGCCGGGGCCCTCTGCAGCACCTTTGAGTCCTACTTCCCCACTCCAGCCGC
CCTTTGTGAAGGCCTCTGGAGCCACTCCTTCAAGGTCAGCAACTATAGTCGAGGGAGCGGCCGCTGCATC
CAGATGTGGTTTGACTCAGCCCAGGGCAACCCCAATGAGGAGGTGGCCAAGTTCTATGCTGCGGCCATGA
ATGCTGGGGCCCCGTCTCGTGGGATTATTGATTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212963 representing NM_000804
Red=Cloning site Green=Tags(s)

MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTAST
SQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCE
RWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCI
QMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000804
ORF Size 735 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000804.4
RefSeq Size 858 bp
RefSeq ORF 738 bp
Locus ID 2352
UniProt ID P41439
Cytogenetics 11q13.4
Domains Folate_rec
Protein Families Druggable Genome, Secreted Protein
MW 27.7 kDa
Summary This gene encodes a member of the folate receptor (FOLR) family of proteins, which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. Expression of this gene may be elevated in ovarian and primary peritoneal carcinoma. This gene is present in a gene cluster on chromosome 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:FOLR3 (NM_000804) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212963L1 Lenti ORF clone of Human folate receptor 3 (gamma) (FOLR3), Myc-DDK-tagged 10 ug
$600.00
RC212963L2 Lenti ORF clone of Human folate receptor 3 (gamma) (FOLR3), mGFP tagged 10 ug
$600.00
RC212963L3 Lenti ORF clone of Human folate receptor 3 (gamma) (FOLR3), Myc-DDK-tagged 10 ug
$600.00
RC212963L4 Lenti ORF clone of Human folate receptor 3 (gamma) (FOLR3), mGFP tagged 10 ug
$600.00
RG212963 FOLR3 (tGFP-tagged) - Human folate receptor 3 (gamma) (FOLR3) 10 ug
$500.00
SC119667 FOLR3 (untagged)-Human folate receptor 3 (gamma) (FOLR3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.