NANOS2 (NM_001029861) Human Tagged ORF Clone
SKU
RC212815
NANOS2 (Myc-DDK-tagged)-Human nanos homolog 2 (Drosophila) (NANOS2)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | NANOS2 |
Synonyms | NOS2; ZC2HC12B |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC212815 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAGCTGCCACCCTTCGACATGTGGAAGGACTACTTCAACCTGAGCCAGGTGGTGTGGGCGCTGATCG CAAGTCGGGGTCAAAGGCTGGAGACCCAAGAGATTGAGGAGCCAAGTCCCGGGCCTCCGCTGGGGCAGGA TCAGGGGCTGGGGGCGCCAGGGGCCAACGGGGGCCTGGGGACCCTGTGCAACTTCTGCAAGCACAACGGG GAGTCCCGCCACGTCTACTCCTCACACCAGCTGAAGACACCGGATGGCGTGGTGGTGTGTCCCATCCTGA GGCACTACGTGTGTCCCGTGTGCGGGGCCACCGGTGACCAGGCCCATACGCTCAAGTACTGCCCGCTTAA CGGTGGCCAGCAGTCCCTCTACCGCCGCAGCGGGCGCAACTCGGCCGGACGCAGGGTCAAGCGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC212815 protein sequence
Red=Cloning site Green=Tags(s) MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNG ESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001029861 |
ORF Size | 414 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_001029861.3 |
RefSeq Size | 1577 bp |
RefSeq ORF | 417 bp |
Locus ID | 339345 |
UniProt ID | P60321 |
Cytogenetics | 19q13.32 |
MW | 15.1 kDa |
Summary | Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state (By similarity).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC212815L1 | Lenti ORF clone of Human nanos homolog 2 (Drosophila) (NANOS2), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC212815L2 | Lenti ORF clone of Human nanos homolog 2 (Drosophila) (NANOS2), mGFP tagged | 10 ug |
$450.00
|
|
RC212815L3 | Lenti ORF clone of Human nanos homolog 2 (Drosophila) (NANOS2), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC212815L4 | Lenti ORF clone of Human nanos homolog 2 (Drosophila) (NANOS2), mGFP tagged | 10 ug |
$450.00
|
|
RG212815 | NANOS2 (tGFP-tagged) - Human nanos homolog 2 (Drosophila) (NANOS2) | 10 ug |
$350.00
|
|
SC302446 | NANOS2 (untagged)-Human nanos homolog 2 (Drosophila) (NANOS2) | 10 ug |
$165.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.