ATP5MC2 (NM_005176) Human Tagged ORF Clone
SKU
RC212805
ATP5G2 (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) (ATP5G2), nuclear gene encoding mitochondrial protein, transcript variant 2
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | ATP5MC2 |
Synonyms | ATP5A; ATP5G2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC212805 representing NM_005176
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCTGAGCTGATCCTGTATGTTGCAATCACTCTATCCGTGGCTGAGCGACTCGTTGGCCCGGGTCACG CATGCGCTGAGCCTTCCTTTCGCTCTTCCCGCTGCTCCGCCCCTCTCTGTCTTCTCTGCAGTGGGAGCAG CTCTCCTGCCACAGCTCCTCACCCCCTGAAAATGTTCGCCTGCTCCAAGTTTGTCTCCACTCCCTCCTTG GTCAAGAGCACCTCACAGCTGCTGAGCCGTCCGCTATCTGCAGTGGTGCTGAAACGACCGGAGATACTGA CAGATGAGAGCCTCAGCAGCTTGGCAGTCTCATGTCCCCTTACCTCACTTGTCTCTAGCCGCAGCTTCCA AACCAGCGCCATTTCAAGGGACATCGACACAGCAGCCAAGTTCATTGGAGCTGGGGCTGCCACAGTTGGG GTGGCTGGTTCTGGGGCTGGGATTGGAACTGTGTTTGGGAGCCTCATCATTGGTTATGCCAGGAACCCTT CTCTGAAGCAACAGCTCTTCTCCTACGCCATTCTGGGCTTTGCCCTCTCGGAGGCCATGGGGCTCTTTTG TCTGATGGTAGCCTTTCTCATCCTCTTTGCCATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC212805 representing NM_005176
Red=Cloning site Green=Tags(s) MPELILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPLCLLCSGSSSPATAPHPLKMFACSKFVSTPSL VKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVG VAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005176 |
ORF Size | 594 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_005176.5, NP_005167.2 |
RefSeq Size | 898 bp |
RefSeq ORF | 426 bp |
Locus ID | 517 |
UniProt ID | Q06055 |
Cytogenetics | 12q13.13 |
Domains | ATP-synt_C |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
MW | 20.51 kDa |
Summary | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). There are three separate genes which encode subunit c of the proton channel and they specify precursors with different import sequences but identical mature proteins. The protein encoded by this gene is one of three precursors of subunit c. This gene has multiple pseudogenes. [provided by RefSeq, Jan 2018] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC212805L3 | Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) (ATP5G2), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC212805L4 | Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) (ATP5G2), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged | 10 ug |
$600.00
|
|
RG212805 | ATP5G2 (tGFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) (ATP5G2), nuclear gene encoding mitochondrial protein, transcript variant 2 | 10 ug |
$500.00
|
|
SC116891 | ATP5G2 (untagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) (ATP5G2), nuclear gene encoding mitochondrial protein, transcript variant 2 | 10 ug |
$150.00
|
|
SC317292 | ATP5G2 (untagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) (ATP5G2), nuclear gene encoding mitochondrial protein, transcript variant 2 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.