Nebulette (NEBL) (NM_213569) Human Tagged ORF Clone

SKU
RC212733
NEBL (Myc-DDK-tagged)-Human nebulette (NEBL), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Nebulette
Synonyms bA165O3.1; C10orf113; LASP2; LNEBL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212733 representing NM_213569
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCCCCAGTGCGCCCGTTGCGGAAAAGTCGTGTATCCCACCGAGAAAGTCAACTGCCTGGATAAGT
ATTGGCATAAAGGATGTTTCCATTGTGAGGTCTGCAAGATGGCACTCAACATGAACAACTACAAAGGCTA
TGAAAAGAAGCCCTATTGTAATGCACACTACCCGAAGCAGTCCTTCACCACGGTGGCAGATACACCTGAA
AATCTTCGCCTGAAGCAGCAAAGTGAATTGCAGAGTCAGGTCAAGTACAAAAGAGATTTTGAAGAAAGCA
AAGGGAGGGGCTTCAGCATCGTCACGGACACTCCTGAGCTACAGAGACTGAAGAGGACTCAGGAGCAAAT
CAGTAATGTAAAATACCATGAAGATTTTGAAAAAACAAAGGGGAGAGGCTTTACTCCCGTCGTGGACGAT
CCTGTGACAGAGAGAGTGAGGAAGAACACCCAGGTGGTCAGCGATGCTGCCTATAAAGGGGTCCACCCTC
ACATCGTGGAGATGGACAGGAGACCTGGAATCATTGTTGCACCTGTTCTTCCCGGAGCCTATCAGCAAAG
CCATTCCCAAGGCTATGGCTACATGCACCAGACCAGTGTGTCATCCATGAGATCAATGCAGCATTCACCA
AATCTAAGGACCTACCGAGCCATGTACGATTACAGTGCCCAGGATGAAGACGAGGTCTCCTTTAGAGACG
GCGACTACATCGTCAACGTGCAGCCTATTGACGATGGCTGGATGTACGGCACAGTGCAGAGAACAGGGAG
AACAGGAATGCTCCCAGCGAATTACATTGAGTTTGTTAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212733 representing NM_213569
Red=Cloning site Green=Tags(s)

MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQSFTTVADTPE
NLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDD
PVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQHSP
NLRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_213569
ORF Size 810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_213569.2, NP_998734.1
RefSeq Size 1245 bp
RefSeq ORF 813 bp
Locus ID 10529
UniProt ID O76041
Cytogenetics 10p12.31
MW 31 kDa
Summary This gene encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril assembly. A shorter isoform of this protein termed LIM nebulette is expressed in non-muscle cells and may function as a component of focal adhesion complexes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:Nebulette (NEBL) (NM_213569) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212733L3 Lenti ORF clone of Human nebulette (NEBL), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC212733L4 Lenti ORF clone of Human nebulette (NEBL), transcript variant 2, mGFP tagged 10 ug
$600.00
RG212733 NEBL (tGFP-tagged) - Human nebulette (NEBL), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC308659 NEBL (untagged)-Human nebulette (NEBL), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.