AMHR2 (NM_020547) Human Tagged ORF Clone

CAT#: RC212425

Reviews ()
Write a review

AMHR2 (Myc-DDK-tagged)-Human anti-Mullerian hormone receptor, type II (AMHR2), transcript variant 1



  "NM_020547" in other vectors (6)

USD 480.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name AMHR2 (NM_020547) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AMHR2
Synonyms AMHR; MISR2; MISRII; MRII
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC212425 representing NM_020547
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTAGGGTCTTTGGGGCTTTGGGCATTACTTCCCACAGCTGTGGAAGCACCCCCAAACAGGCGAACCT
GTGTGTTCTTTGAGGCCCCTGGAGTGCGGGGAAGCACAAAGACACTGGGAGAGCTGCTAGATACAGGCAC
AGAGCTCCCCAGAGCTATCCGCTGCCTCTACAGCCGCTGCTGCTTTGGGATCTGGAACCTGACCCAAGAC
CGGGCACAGGTGGAAATGCAAGGATGCCGAGACAGTGATGAGCCAGGCTGTGAGTCCCTCCACTGTGACC
CAAGTCCCCGAGCCCACCCCAGCCCTGGCTCCACTCTCTTCACCTGCTCCTGTGGCACTGACTTCTGCAA
TGCCAATTACAGCCATCTGCCTCCTCCAGGGAGCCCTGGGACTCCTGGCTCCCAGGGTCCCCAGGCTGCC
CCAGGTGAGTCCATCTGGATGGCACTGGTGCTGCTGGGGCTGTTCCTCCTCCTCCTGCTGCTGCTGGGCA
GCATCATCTTGGCCCTGCTACAGCGAAAGAACTACAGAGTGCGAGGTGAGCCAGTGCCAGAGCCAAGGCC
AGACTCAGGCAGGGACTGGAGTGTGGAGCTGCAGGAGCTGCCTGAGCTGTGTTTCTCCCAGCAGGTAATC
CGGGAAGGAGGTCATGCAGTGGTTTGGGCCGGGCAGCTGCAAGGAAAACTGGTTGCCATCAAGGCCTTCC
CACCGAGGTCTGTGGCTCAGTTCCAAGCTGAGAGAGCATTGTACGAACTTCCAGGCCTACAGCACGACCA
CATTGTCCGATTTATCACTGCCAGCCGGGGGGGTCCTGGCCGCCTGCTCTCTGGGCCCCTGCTGGTACTG
GAACTGCATCCCAAGGGCTCCCTGTGCCACTACTTGACCCAGTACACCAGTGACTGGGGAAGTTCCCTGC
GGATGGCACTGTCCCTGGCCCAGGGCCTGGCATTTCTCCATGAGGAGCGCTGGCAGAATGGCCAAAATAA
ACCAGGTATTGCCCACCGAGATCTGAGCAGCCAGAATGTGCTCATTCGGGAAGATGGATCGTGTGCCATT
GGAGACCTGGGCCTTGCCTTGGTGCTCCCTGGCCTCACTCAGCCCCCTGCCTGGACCCCTACTCAACCAC
AAGGCCCAGCTGCCATCATGGAAGCTGGCACCCAGAGGTACATGGCACCAGAGCTCTTGGACAAGACTCT
GGACCTACAGGATTGGGGCATGGCCCTCCGACGAGCTGATATTTACTCTTTGGCTCTGCTCCTGTGGGAG
ATACTGAGCCGCTGCCCAGATTTGAGGCCTGACAGCAGTCCACCACCCTTCCAACTGGCCTATGAGGCAG
AACTGGGCAATACCCCTACCTCTGATGAGCTATGGGCCTTGGCAGTGCAGGAGAGGAGGCGTCCCTACAT
CCCATCCACCTGGCGCTGCTTTGCCACAGACCCTGATGGGCTGAGGGAGCTCCTAGAAGACTGTTGGGAT
GCAGACCCAGAAGCACGGCTGACAGCTGAGTGTGTACAGCAGCGCCTGGCTGCCTTGGCCCATCCTCAAG
AGAGCCACCCCTTTCCAGAGAGCTGTCCACGTGGCTGCCCACCTCTCTGCCCAGAAGACTGTACTTCAAT
TCCTGCCCCTACCATCCTCCCCTGTAGGCCTCAGCGGAGTGCCTGCCACTTCAGCGTTCAGCAAGGCCCT
TGTTCCAGGAATCCTCAGCCTGCCTGTACCCTTTCTCCTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212425 representing NM_020547
Red=Cloning site Green=Tags(s)

MLGSLGLWALLPTAVEAPPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQD
RAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAA
PGESIWMALVLLGLFLLLLLLLGSIILALLQRKNYRVRGEPVPEPRPDSGRDWSVELQELPELCFSQQVI
REGGHAVVWAGQLQGKLVAIKAFPPRSVAQFQAERALYELPGLQHDHIVRFITASRGGPGRLLSGPLLVL
ELHPKGSLCHYLTQYTSDWGSSLRMALSLAQGLAFLHEERWQNGQNKPGIAHRDLSSQNVLIREDGSCAI
GDLGLALVLPGLTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE
ILSRCPDLRPDSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTWRCFATDPDGLRELLEDCWD
ADPEARLTAECVQQRLAALAHPQESHPFPESCPRGCPPLCPEDCTSIPAPTILPCRPQRSACHFSVQQGP
CSRNPQPACTLSPV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020547
ORF Size 1722 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020547.1, NM_020547.2, NM_020547.3, NP_065434.1
RefSeq Size 1855 bp
RefSeq ORF 1722 bp
Locus ID 269
Cytogenetics 12q13.13
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, TGF-beta signaling pathway
MW 62.6 kDa
Gene Summary This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Sep 2009]

Citations (1)

Other Versions

Other products for "AMHR2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Anti-AMHR2 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools