PSMB11 (NM_001099780) Human Tagged ORF Clone

SKU
RC212390
PSMB11 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 11 (PSMB11)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMB11
Synonyms BETA5T
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212390 representing NM_001099780
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTGCAGGATGTGTGCAAGTGGCAGTCCCCTGACACCCAGGGACCATCACCTCACCTGCCTCGGG
CTGGCGGCTGGGCTGTGCCCCGGGGTTGTGACCCTCAAACCTTCCTGCAGATCCATGGCCCCAGACTGGC
CCACGGCACCACCACTCTGGCCTTCCGCTTCCGTCATGGAGTCATTGCTGCAGCTGACACGCGTTCCTCC
TGTGGCAGCTATGTGGCGTGTCCAGCCTCATGCAAGGTCATCCCTGTGCACCAGCACCTCCTGGGTACCA
CCTCTGGCACCTCTGCCGACTGTGCTACCTGGTATCGGGTATTACAGCGGGAGCTGCGGCTTCGGGAACT
GAGGGAGGGTCAGCTGCCCAGTGTGGCCAGTGCTGCCAAGCTCTTGTCAGCCATGATGTCTCAATACCGG
GGACTGGATCTCTGTGTGGCCACTGCCCTCTGCGGCTGGGACCGCTCTGGCCCTGAGCTCTTCTACGTCT
ATAGCGACGGCACCCGCCTGCAGGGGGACATCTTCTCTGTGGGCTCTGGATCTCCCTATGCCTACGGCGT
GCTAGACCGTGGCTATCGCTACGACATGAGCACCCAGGAAGCCTACGCCCTGGCTCGCTGCGCCGTGGCC
CACGCCACCCACCGTGATGCCTATTCAGGGGGCTCTGTAGACCTTTTCCACGTGCGGGAGAGTGGATGGG
AGCATGTGTCACGCAGTGATGCCTGTGTGCTGTACGTGGAGTTACAGAAGCTCCTGGAGCCGGAGCCAGA
GGAGGATGCCAGCCATGCCCATCCTGAGCCTGCCACTGCCCACAGAGCTGCAGAAGATAGAGAGCTCTCT
GTGGGGCCAGGGGAGGTGACACCAGGAGACTCCAGGATGCCAGCAGGGACTGAGACGGTG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212390 representing NM_001099780
Red=Cloning site Green=Tags(s)

MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSS
CGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYR
GLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVA
HATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELS
VGPGEVTPGDSRMPAGTETV

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_001099780
ORF Size 900 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001099780.2
RefSeq Size 1894 bp
RefSeq ORF 903 bp
Locus ID 122706
UniProt ID A5LHX3
Cytogenetics 14q11.2
Protein Pathways Proteasome
MW 32.3 kDa
Summary Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1 (PSMB6; MIM 600307), beta-2 (PSMB7; MIM 604030), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i (PSMB9; MIM 177045), beta-2i (PSMB10; MIM 176847), and beta-5i (PSMB8; MIM 177046), are induced by gamma-interferon (IFNG; MIM 147570) and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells (Murata et al., 2007 [PubMed 17540904]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:PSMB11 (NM_001099780) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212390L3 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 11 (PSMB11), Myc-DDK-tagged 10 ug
$600.00
RC212390L4 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 11 (PSMB11), mGFP tagged 10 ug
$600.00
RG212390 PSMB11 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 11 (PSMB11) 10 ug
$500.00
SC316717 PSMB11 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 11 (PSMB11) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.