SIRT4 (NM_012240) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC212226
SIRT4 (Myc-DDK-tagged)-Human sirtuin 4 (SIRT4)
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SIRT4
Synonyms SIR2L4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212226 representing NM_012240
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGATGAGCTTTGCGTTGACTTTCAGGTCAGCAAAAGGCCGTTGGATCGCAAACCCCAGCCAGCCGT
GCTCGAAAGCCTCCATTGGGTTATTTGTGCCAGCAAGTCCTCCTCTGGACCCTGAGAAGGTCAAAGAGTT
ACAGCGCTTCATCACCCTTTCCAAGAGACTCCTTGTGATGACTGGGGCAGGAATCTCCACCGAATCGGGG
ATACCAGACTACAGGTCAGAAAAAGTGGGGCTTTATGCCCGCACTGACCGCAGGCCCATCCAGCATGGTG
ATTTTGTCCGGAGTGCCCCAATCCGCCAGCGGTACTGGGCGAGAAACTTCGTAGGCTGGCCTCAATTCTC
CTCCCACCAGCCTAACCCTGCACACTGGGCTTTGAGCACCTGGGAGAAACTCGGAAAGCTGTACTGGTTG
GTGACCCAAAATGTGGATGCTTTGCACACCAAGGCGGGGAGTCGGCGCCTGACAGAGCTCCACGGATGCA
TGGACAGGGTCCTGTGCTTGGATTGTGGGGAACAGACTCCCCGGGGGGTGCTGCAAGAGCGTTTCCAAGT
CCTGAACCCCACCTGGAGTGCTGAGGCCCATGGCCTGGCTCCTGATGGTGACGTCTTTCTCTCAGAGGAG
CAAGTCCGGAGCTTTCAGGTCCCAACCTGCGTTCAATGTGGAGGCCATCTGAAACCAGATGTCGTTTTCT
TCGGGGACACAGTGAACCCTGACAAGGTTGATTTTGTGCACAAGCGTGTAAAAGAAGCCGACTCCCTCTT
GGTGGTGGGATCATCCTTGCAGGTATACTCTGGTTACAGGTTTATCCTCACTGCCTGGGAGAAGAAGCTC
CCGATTGCAATACTGAACATTGGGCCCACACGGTCGGATGACTTGGCGTGTCTGAAACTGAATTCTCGTT
GTGGAGAGTTGCTGCCTTTGATAGACCCATGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212226 representing NM_012240
Red=Cloning site Green=Tags(s)

MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESG
IPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWL
VTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEE
QVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKL
PIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012240
ORF Size 942 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012240.2
RefSeq Size 1174 bp
RefSeq ORF 945 bp
Locus ID 23409
UniProt ID Q9Y6E7
Cytogenetics 12q24.23-q24.31
Domains SIR2
Protein Families Druggable Genome, Transcription Factors
MW 35 kDa
Summary This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family. [provided by RefSeq, Jul 2008]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
RC212226L1 Lenti ORF clone of Human sirtuin 4 (SIRT4), Myc-DDK-tagged 10 ug
$600.00
RC212226L2 Lenti ORF clone of Human sirtuin 4 (SIRT4), mGFP tagged 10 ug
$600.00
RC212226L3 Lenti ORF clone of Human sirtuin 4 (SIRT4), Myc-DDK-tagged 10 ug
$600.00
RC212226L4 Lenti ORF clone of Human sirtuin 4 (SIRT4), mGFP tagged 10 ug
$600.00
RG212226 SIRT4 (tGFP-tagged) - Human sirtuin 4 (SIRT4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC310543 SIRT4 (untagged)-Human sirtuin 4 (SIRT4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.