AGTRAP (NM_020350) Human Tagged ORF Clone

SKU
RC212155
AGTRAP (Myc-DDK-tagged)-Human angiotensin II receptor-associated protein (AGTRAP), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AGTRAP
Synonyms ATRAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212155 representing NM_020350
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGCCTGCTGTGAACCTGAAGGTGATTCTCCTAGGTCACTGGCTGCTGACAACCTGGGGCTGCA
TTGTATTCTCAGGCTCCTATGCCTGGGCCAACTTCACCATCCTGGCCTTGGGCGTGTGGGCTGTGGCTCA
GCGGGACTCCATCGACGCCATAAGCATGTTTCTGGGTGGCTTGCTGGCCACCATCTTCCTGGACATCGTG
CACATCAGCATCTTCTACCCGCGGGTCAGCCTCACGGACACGGGCCGCTTTGGCGTGGGCATGGCCATCC
TCAGCTTGCTGCTCAAGCCGCTCTCCTGCTGCTTCGTCTACCACATGTACCGGGAGCGCGGGGGTGAGCT
CCTGGTCCACACTGGTTTCCTTGGGTCTTCTCAGGACCGTAGTGCCTACCAGACGATTGACTCAGCAGAG
GCGCCCGCAGATCCCTTTGCAGTCCCAGAGGGCAGGAGTCAAGATGCCCGAGGGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212155 representing NM_020350
Red=Cloning site Green=Tags(s)

MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIV
HISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAE
APADPFAVPEGRSQDARGY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020350
ORF Size 477 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020350.5
RefSeq Size 1108 bp
RefSeq ORF 480 bp
Locus ID 57085
UniProt ID Q6RW13
Cytogenetics 1p36.22
Protein Families Druggable Genome, Transmembrane
MW 17.2 kDa
Summary This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:AGTRAP (NM_020350) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212155L1 Lenti ORF clone of Human angiotensin II receptor-associated protein (AGTRAP), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC212155L2 Lenti ORF clone of Human angiotensin II receptor-associated protein (AGTRAP), transcript variant 1, mGFP tagged 10 ug
$450.00
RC212155L3 Lenti ORF clone of Human angiotensin II receptor-associated protein (AGTRAP), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC212155L4 Lenti ORF clone of Human angiotensin II receptor-associated protein (AGTRAP), transcript variant 1, mGFP tagged 10 ug
$450.00
RG212155 AGTRAP (tGFP-tagged) - Human angiotensin II receptor-associated protein (AGTRAP), transcript variant 1 10 ug
$489.00
SC113135 AGTRAP (untagged)-Human angiotensin II receptor-associated protein (AGTRAP), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.