RGS4 (NM_001102445) Human Tagged ORF Clone

SKU
RC212133
RGS4 (Myc-DDK-tagged)-Human regulator of G-protein signaling 4 (RGS4), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RGS4
Synonyms RGP4; SCZD9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212133 representing NM_001102445
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATAATATGATGCTTCTAATCCAAAAGAGGAAAGGCATTGGGAGTCAGCTCCTAAGGGCTGGAGAGG
CAGAGGGAGACAGAGGAGCTGGTACTGCAGAGCGGTCGTCTGATTGGCTGGACGGTCGTAGCTGGGCTAT
AAAAGAGACCCCTACAGGCTTAGCAGGAAGACGCTCAGAGGATTCTGACAATATCTTTACCGGAGAAGAG
GCAAAGTACGCTCAAAGCCGAAGCCACAGCTCCTCCTGCCGCATTTCTTTCCTGCTTGCGAATTCCAAGC
TGTTAAATAAGATGTGCAAAGGGCTTGCAGGTCTGCCGGCTTCTTGCTTGAGGAGTGCAAAAGATATGAA
ACATCGGCTAGGTTTCCTGCTGCAAAAATCTGATTCCTGTGAACACAATTCTTCCCACAACAAGAAGGAC
AAAGTGGTTATTTGCCAGAGAGTGAGCCAAGAGGAAGTCAAGAAATGGGCTGAATCACTGGAAAACCTGA
TTAGTCATGAATGTGGGCTGGCAGCTTTCAAAGCTTTCTTGAAGTCTGAATATAGTGAGGAGAATATTGA
CTTCTGGATCAGCTGTGAAGAGTACAAGAAAATCAAATCACCATCTAAACTAAGTCCCAAGGCCAAAAAG
ATCTATAATGAATTCATCTCAGTCCAGGCAACCAAAGAGGTGAACCTGGATTCTTGCACCAGGGAAGAGA
CAAGCCGGAACATGCTAGAGCCTACAATAACCTGCTTTGATGAGGCCCAGAAGAAGATTTTCAACCTGAT
GGAGAAGGATTCCTACCGCCGCTTCCTCAAGTCTCGATTCTATCTTGATTTGGTCAACCCGTCCAGCTGT
GGGGCAGAAAAGCAGAAAGGAGCCAAGAGTTCAGCAGACTGTGCTTCCCTGGTCCCTCAGTGTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212133 representing NM_001102445
Red=Cloning site Green=Tags(s)

MYNMMLLIQKRKGIGSQLLRAGEAEGDRGAGTAERSSDWLDGRSWAIKETPTGLAGRRSEDSDNIFTGEE
AKYAQSRSHSSSCRISFLLANSKLLNKMCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKD
KVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKK
IYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSC
GAEKQKGAKSSADCASLVPQCA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001102445
ORF Size 906 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001102445.2, NP_001095915.1
RefSeq Size 3215 bp
RefSeq ORF 909 bp
Locus ID 5999
UniProt ID P49798
Cytogenetics 1q23.3
Protein Families Druggable Genome
MW 33.7 kDa
Summary Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RGS4 (NM_001102445) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212133L3 Lenti ORF clone of Human regulator of G-protein signaling 4 (RGS4), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC212133L4 Lenti ORF clone of Human regulator of G-protein signaling 4 (RGS4), transcript variant 1, mGFP tagged 10 ug
$600.00
RG212133 RGS4 (tGFP-tagged) - Human regulator of G-protein signaling 4 (RGS4), transcript variant 1 10 ug
$500.00
SC316920 RGS4 (untagged)-Human regulator of G-protein signaling 4 (RGS4), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.