PHOS (PDC) (NM_022576) Human Tagged ORF Clone

SKU
RC212016
PDC (Myc-DDK-tagged)-Human phosducin (PDC), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PHOS
Synonyms MEKA; PHD; PhLOP; PhLP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212016 representing NM_022576
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCTCCTCAGAGTAGGAATGGCAAAGATTCAAAGGAACGAGTCAGCAGAAAGATGAGCATTCAAG
AATATGAACTAATCCATAAAGAGAAAGAGGATGAAAACTGCCTTCGTAAATACCGTAGACAGTGTATGCA
GGATATGCACCAGAAGCTGAGTTTTGGGCCTAGATATGGGTTTGTGTATGAGCTGGAAACTGGAAAGCAA
TTCCTAGAAACAATTGAAAAGGAACTGAAGATCACCACAATTGTTGTTCACATTTATGAAGATGGTATTA
AGGGTTGTGATGCTCTAAACAGTAGTTTAACATGCCTTGCAGCAGAATACCCTATAGTTAAGTTTTGTAA
AATAAAAGCTTCGAATACAGGTGCTGGGGACCGCTTTTCCTTAGATGTACTTCCTACACTGCTCATCTAT
AAAGGTGGGGAACTCATAAGCAATTTTATTAGTGTTGCTGAACAGTTTGCTGAAGAATTTTTTGCTGGGG
ATGTGGAGTCTTTCCTAAATGAATATGGGTTACTACCTGAAAGAGAGGTACATGTCCTAGAGCATACCAA
AATAGAAGAAGAAGATGTTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212016 representing NM_022576
Red=Cloning site Green=Tags(s)

MSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGKQ
FLETIEKELKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDRFSLDVLPTLLIY
KGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREVHVLEHTKIEEEDVE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022576
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022576.3, NP_072098.1
RefSeq Size 1221 bp
RefSeq ORF 585 bp
Locus ID 5132
UniProt ID P20941
Cytogenetics 1q31.1
Protein Families Druggable Genome
Protein Pathways Olfactory transduction
MW 22.1 kDa
Summary This gene encodes a phosphoprotein, which is located in the outer and inner segments of the rod cells in the retina. This protein may participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. It modulates the phototransduction cascade by interacting with the beta and gamma subunits of the retinal G-protein transducin. This gene is a potential candidate gene for retinitis pigmentosa and Usher syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PHOS (PDC) (NM_022576) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212016L3 Lenti ORF clone of Human phosducin (PDC), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC212016L4 Lenti ORF clone of Human phosducin (PDC), transcript variant 2, mGFP tagged 10 ug
$600.00
RG212016 PDC (tGFP-tagged) - Human phosducin (PDC), transcript variant 2 10 ug
$500.00
SC305039 PDC (untagged)-Human phosducin (PDC), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.