SLURP2 (NM_177458) Human Tagged ORF Clone

SKU
RC211711
LYNX1 (Myc-DDK-tagged)-Human Ly6/neurotoxin 1 (LYNX1), transcript variant SLURP2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SLURP2
Synonyms SLURP-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211711 representing NM_177458
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCTCGGCACTGGGCTCCTGCTGGCCGCCGTCCTGAGCCTGCAGCTGGCTGCAGCCGAAGCCATAT
GGTGTCACCAGTGCACGGGCTTCGGAGGGTGCTCCCATGGATCCAGATGCCTGAGGGACTCCACCCACTG
TGTCACCACTGCCACCCGGGTCCTCAGCAACACCGAGGATTTGCCTCTGGTCACCAAGATGTGCCACATA
GGCTGCCCCGATATCCCCAGCCTGGGCCTGGGCCCCTACGTATCCATCGCTTGCTGCCAGACCAGCCTCT
GCAACCATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211711 representing NM_177458
Red=Cloning site Green=Tags(s)

MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHI
GCPDIPSLGLGPYVSIACCQTSLCNHD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_177458
ORF Size 291 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177458.3
RefSeq Size 589 bp
RefSeq ORF 294 bp
Locus ID 432355
UniProt ID P0DP57
Cytogenetics 8q24.3
MW 10 kDa
Summary This gene encodes a novel, secreted member of the Ly6/uPAR (LU) superfamily of proteins containing the unique three-finger LU domain. This gene is mainly expressed in epithelial cells, including skin and keratinocytes, and is up-regulated in psoriatic skin lesions, suggesting its involvement in the pathophysiology of psoriasis. Alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (LYNX1) generates naturally-occurring transcripts (LYNX1-SLURP2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Sep 2017]
Write Your Own Review
You're reviewing:SLURP2 (NM_177458) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211711L3 Lenti ORF clone of Human Ly6/neurotoxin 1 (LYNX1), transcript variant SLURP2, Myc-DDK-tagged 10 ug
$450.00
RC211711L4 Lenti ORF clone of Human Ly6/neurotoxin 1 (LYNX1), transcript variant SLURP2, mGFP tagged 10 ug
$450.00
RG211711 LYNX1 (tGFP-tagged) - Human Ly6/neurotoxin 1 (LYNX1), transcript variant SLURP2 10 ug
$489.00
SC307098 LYNX1 (untagged)-Human Ly6/neurotoxin 1 (LYNX1), transcript variant SLURP2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.