CTAG2 (NM_172377) Human Tagged ORF Clone

SKU
RC211659
CTAG2 (Myc-DDK-tagged)-Human cancer/testis antigen 2 (CTAG2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CTAG2
Synonyms CAMEL; CT2; CT6.2; CT6.2a; CT6.2b; ESO2; LAGE-1; LAGE2B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211659 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCCGAAGGCCGGGGCACAGGGGGTTCGACGGGCGATGCTGATGGCCCAGGAGGCCCTGGCATTC
CTGATGGCCCAGGGGGCAATGCTGGCGGCCCAGGAGAGGCGGGTGCCACGGGCGGCAGAGGTCCCCGGGG
CGCAGGGGCAGCAAGGGCCTCGGGGCCGAGAGGAGGCGCCCCGCGGGGTCCGCATGGCGGTGCCGCTTCT
GCGCAGGATGGAAGGTGCCCCTGCGGGGCCAGGAGGCCGGACAGCCGCCTGCTTGAGTTGCACATCACGA
TGCCTTTCTCGTCGCCCATGGAAGCGGAGCTGGTCCGCAGGATCCTGTCCCGGGATGCCGCACCGCTCCC
CCGACCAGGGGCGGTTCTGAAGGACTTCACCGTGTCCGGCAACCTACTGTTTATCCGACTGACTGCTGCA
GACCACCGCCAACTGCAGCTCTCCATCAGCTCCTGTCTCCAGCAGCTTTCCCTGTTGATGTGGATCACGC
AGTGCTTTCTGCCCGTGTTTTTGGCTCAGGCTCCCTCAGGGCAGAGGCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211659 protein sequence
Red=Cloning site Green=Tags(s)

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAAS
AQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFIRLTAA
DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQAPSGQRR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_172377
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_172377.4
RefSeq Size 773 bp
RefSeq ORF 543 bp
Locus ID 30848
UniProt ID O75638
Cytogenetics Xq28
MW 18.3 kDa
Summary This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is also expressed in normal testis tissue. An alternative open reading frame product of this gene has been described in PMID:10399963. This alternate protein, termed CAMEL, is a tumor antigen that is recognized by melanoma-specific cytotoxic T-lymphocytes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Write Your Own Review
You're reviewing:CTAG2 (NM_172377) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211659L1 Lenti ORF clone of Human cancer/testis antigen 2 (CTAG2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC211659L2 Lenti ORF clone of Human cancer/testis antigen 2 (CTAG2), transcript variant 1, mGFP tagged 10 ug
$600.00
RC211659L3 Lenti ORF clone of Human cancer/testis antigen 2 (CTAG2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC211659L4 Lenti ORF clone of Human cancer/testis antigen 2 (CTAG2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG211659 CTAG2 (tGFP-tagged) - Human cancer/testis antigen 2 (CTAG2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC306767 CTAG2 (untagged)-Human cancer/testis antigen 2 (CTAG2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.