CBFB (NM_022845) Human Tagged ORF Clone
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
SKU
RC211623
CBFB (Myc-DDK-tagged)-Human core-binding factor, beta subunit (CBFB), transcript variant 1
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | CBFB |
Synonyms | PEBP2B |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC211623 representing NM_022845
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGCGCGTCGTGCCCGACCAGAGAAGCAAGTTCGAGAACGAGGAGTTTTTTAGGAAGCTGAGCCGCG AGTGTGAGATTAAGTACACGGGCTTCAGGGACCGGCCCCACGAGGAACGCCAGGCACGCTTCCAGAACGC CTGCCGCGACGGCCGCTCGGAAATCGCTTTTGTGGCCACAGGAACCAATCTGTCTCTCCAGTTTTTTCCG GCCAGCTGGCAGGGAGAACAGCGACAAACACCTAGCCGAGAGTATGTCGACTTAGAAAGAGAAGCAGGCA AGGTATATTTGAAGGCTCCCATGATTCTGAATGGAGTCTGTGTTATCTGGAAAGGCTGGATTGATCTCCA AAGACTGGATGGTATGGGCTGTCTGGAGTTTGATGAGGAGCGAGCCCAGCAGGAGGATGCATTAGCACAA CAGGCCTTTGAAGAGGCTCGGAGAAGGACACGCGAATTTGAAGATAGAGACAGGTCTCATCGGGAGGAAA TGGAGGCAAGAAGACAACAAGACCCTAGTCCTGGTTCCAATTTAGGTGGTGGTGATGACCTCAAACTTCG T ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211623 representing NM_022845
Red=Cloning site Green=Tags(s) MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQ QAFEEARRRTREFEDRDRSHREEMEARRQQDPSPGSNLGGGDDLKLR myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_022845 |
ORF Size | 561 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_022845.3 |
RefSeq Size | 3150 bp |
RefSeq ORF | 564 bp |
Locus ID | 865 |
UniProt ID | Q13951 |
Cytogenetics | 16q22.1 |
Domains | CBF_beta |
Protein Families | Druggable Genome, Transcription Factors |
MW | 21.8 kDa |
Summary | The protein encoded by this gene is the beta subunit of a heterodimeric core-binding transcription factor belonging to the PEBP2/CBF transcription factor family which master-regulates a host of genes specific to hematopoiesis (e.g., RUNX1) and osteogenesis (e.g., RUNX2). The beta subunit is a non-DNA binding regulatory subunit; it allosterically enhances DNA binding by alpha subunit as the complex binds to the core site of various enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers and GM-CSF promoters. Alternative splicing generates two mRNA variants, each encoding a distinct carboxyl terminus. In some cases, a pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript consisting of the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain 11. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC211623L1 | Lenti ORF clone of Human core-binding factor, beta subunit (CBFB), transcript variant 1, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC211623L2 | Lenti ORF clone of Human core-binding factor, beta subunit (CBFB), transcript variant 1, mGFP tagged | 10 ug |
$600.00
|
|
RC211623L3 | Lenti ORF clone of Human core-binding factor, beta subunit (CBFB), transcript variant 1, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC211623L4 | Lenti ORF clone of Human core-binding factor, beta subunit (CBFB), transcript variant 1, mGFP tagged | 10 ug |
$600.00
|
|
RG211623 | CBFB (tGFP-tagged) - Human core-binding factor, beta subunit (CBFB), transcript variant 1 | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC110848 | CBFB (untagged)-Human core-binding factor, beta subunit (CBFB), transcript variant 1 | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.